Project name: gp63_004

Status: done

Started: 2026-04-27 15:11:38
Settings
Chain sequence(s) H: QVQLVESGGGLVQPGGSLRLSCAASGDSSFDFSQYSLGWFRQAPGQGLEAVAAISADGSQTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAASKSTQLKNILPESFDYWGQGTLVTVS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:11)
Show buried residues

Minimal score value
-3.1343
Maximal score value
1.6185
Average score
-0.8899
Total score value
-113.0144

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q H -1.5727
2 V H -1.1357
3 Q H -0.7625
4 L H 0.0000
5 V H 1.1479
6 E H 0.0000
7 S H -0.1886
8 G H -0.7307
9 G H 0.1776
10 G H 0.7503
11 L H 1.4414
12 V H -0.0694
13 Q H -1.4157
14 P H -1.8777
15 G H -1.6970
16 G H -1.2032
17 S H -1.4287
18 L H -1.0187
19 R H -2.2271
20 L H 0.0000
21 S H -0.4459
22 C H 0.0000
23 A H -0.1601
24 A H -0.4776
25 S H -0.9762
26 G H -1.3939
27 D H -1.7920
28 S H -1.0363
29 S H -0.6942
30 F H -0.7508
31 D H -1.5206
32 F H 0.0000
33 S H -2.1201
34 Q H -2.2900
35 Y H 0.0000
36 S H 0.0000
37 L H 0.0000
38 G H 0.0000
39 W H 0.0000
40 F H 0.0000
41 R H 0.0000
42 Q H -0.7157
43 A H -0.9900
44 P H -0.9779
45 G H -1.2998
46 Q H -1.8473
47 G H -1.2534
48 L H -0.4102
49 E H -0.7477
50 A H -0.1918
51 V H 0.0000
52 A H 0.0000
53 A H 0.0000
54 I H 0.0000
55 S H -1.7117
56 A H -2.1878
57 D H -2.6771
58 G H -1.8816
59 S H -1.4935
60 Q H -2.0095
61 T H -0.8599
62 Y H 0.0000
63 Y H -0.7328
64 A H -1.3451
65 D H -2.4537
66 S H -1.7666
67 V H 0.0000
68 K H -2.5894
69 G H -1.8664
70 R H -1.8629
71 F H 0.0000
72 T H -1.0853
73 I H 0.0000
74 S H -0.6724
75 R H -1.6085
76 D H -2.4375
77 N H -3.1343
78 S H -2.1100
79 K H -2.7973
80 N H -2.3572
81 T H -1.3794
82 L H 0.0000
83 Y H 0.0000
84 L H 0.0000
85 Q H -1.6954
86 M H 0.0000
87 N H -2.2741
88 S H -1.7327
89 L H 0.0000
90 R H -3.0199
91 A H -2.0327
92 E H -2.4587
93 D H 0.0000
94 T H -0.5169
95 A H 0.0000
96 V H 0.7995
97 Y H 0.0000
98 Y H 0.3328
99 C H 0.0000
100 A H 0.0000
101 A H 0.0000
102 S H 0.0000
103 K H -2.6608
104 S H -1.7572
105 T H -1.8936
106 Q H -2.2078
107 L H -1.8247
108 K H -2.5882
109 N H -2.2190
110 I H -1.0739
111 L H -0.5658
112 P H -0.9371
113 E H -2.0694
114 S H -1.6531
115 F H 0.0000
116 D H -2.2240
117 Y H -0.9174
118 W H -0.0463
119 G H -0.0016
120 Q H -0.6595
121 G H 0.1049
122 T H 0.6420
123 L H 1.6185
124 V H 0.0000
125 T H 0.3046
126 V H 0.0000
127 S H -0.8650
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018