Project name: 434f4d86bfbca54

Chain sequence(s)	A: QSVLTQPPSVSAAPGQKVTISCSGNNSNIGKNYVSWYQQLPGRTPKLIMYENNKRSSGIPDRFSGSKSGNSATLTITGLQTGDEADYYCGVWDSSLSGGVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:56)

• Minimal score value: -3.3025
• Maximal score value: 1.3589
• Average score: -0.8394
• Total score value: -180.4766

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-0.8693
2	S	A	0.0294
3	V	A	0.9077
4	L	A	0.0000
5	T	A	0.1337
6	Q	A	0.0000
7	P	A	-0.4946
8	P	A	-0.6773
9	S	A	-0.5205
11	V	A	-0.3065
12	S	A	-0.6797
13	A	A	0.0000
14	A	A	-1.0160
15	P	A	-1.4691
16	G	A	-1.8061
17	Q	A	-2.4205
18	K	A	-2.5845
19	V	A	0.0000
20	T	A	-0.4421
21	I	A	0.0000
22	S	A	-0.2368
23	C	A	0.0000
24	S	A	-0.5479
25	G	A	-0.6114
26	N	A	-1.5905
27	N	A	-2.5340
28	S	A	-1.3222
29	N	A	0.0000
30	I	A	0.0000
35	G	A	-2.4371
36	K	A	-2.2421
37	N	A	-0.9300
38	Y	A	-0.3210
39	V	A	0.0000
40	S	A	-0.2380
41	W	A	0.0000
42	Y	A	-0.0005
43	Q	A	0.0000
44	Q	A	-1.7377
45	L	A	-1.5825
46	P	A	-1.3556
47	G	A	-1.5521
48	R	A	-2.4503
49	T	A	-1.5181
50	P	A	-1.3834
51	K	A	-1.3000
52	L	A	-0.1366
53	I	A	0.0000
54	M	A	0.0000
55	Y	A	-1.2821
56	E	A	-2.3397
57	N	A	-2.0605
65	N	A	-2.8316
66	K	A	-3.0161
67	R	A	-2.4690
68	S	A	-1.0742
69	S	A	-0.7277
70	G	A	-0.8339
71	I	A	-0.9247
72	P	A	-1.2913
74	D	A	-2.2127
75	R	A	-1.5345
76	F	A	0.0000
77	S	A	-1.4607
78	G	A	-1.5680
79	S	A	-1.3873
80	K	A	-1.4595
83	S	A	-1.0537
84	G	A	-1.7875
85	N	A	-2.3212
86	S	A	-1.2801
87	A	A	0.0000
88	T	A	-0.5469
89	L	A	0.0000
90	T	A	-0.5476
91	I	A	0.0000
92	T	A	-1.8387
93	G	A	-1.5972
94	L	A	0.0000
95	Q	A	-1.8547
96	T	A	-1.0824
97	G	A	-0.9880
98	D	A	0.0000
99	E	A	-1.2739
100	A	A	0.0000
101	D	A	-1.4422
102	Y	A	0.0000
103	Y	A	0.0779
104	C	A	0.0000
105	G	A	0.0000
106	V	A	0.0000
107	W	A	0.9482
108	D	A	0.0000
109	S	A	-0.3842
110	S	A	-0.0620
113	L	A	0.2561
114	S	A	0.0118
115	G	A	-0.2228
116	G	A	0.0756
117	V	A	0.0000
118	F	A	1.1853
119	G	A	0.4755
120	G	A	-0.2338
121	G	A	-0.5102
122	T	A	0.0000
123	K	A	-0.9652
124	V	A	0.0000
125	T	A	0.0000
126	V	A	0.0000
127	L	A	-0.7185
128	G	A	-0.7488
129	Q	A	-1.0824
130	P	A	-1.2479
131	K	A	-2.0775
132	A	A	-1.2023
133	A	A	-0.6393
134	P	A	-0.3898
135	S	A	-0.2205
136	V	A	0.0000
137	T	A	0.4442
138	L	A	0.6313
139	F	A	1.3589
140	P	A	0.4160
141	P	A	0.0000
142	S	A	-1.0515
143	S	A	-1.8886
144	E	A	-2.7657
145	E	A	-2.3122
146	L	A	-2.0113
147	Q	A	-2.5088
148	A	A	-2.0894
149	N	A	-2.8378
150	K	A	-2.9754
151	A	A	0.0000
152	T	A	-0.1438
153	L	A	0.0000
154	V	A	1.0233
155	C	A	0.0000
156	L	A	1.2269
157	I	A	0.0000
158	S	A	-0.6411
159	D	A	-1.8777
160	F	A	0.0000
161	Y	A	0.0000
162	P	A	0.0000
163	G	A	-0.7628
164	A	A	-0.1140
165	V	A	0.0681
166	T	A	0.0309
167	V	A	0.0634
168	A	A	-0.3487
169	W	A	0.0000
170	K	A	-1.1069
171	A	A	0.0000
172	D	A	-1.2849
173	S	A	-0.8826
174	S	A	-0.8198
175	P	A	-0.8791
176	V	A	-0.7627
177	K	A	-1.5864
178	A	A	-0.9269
179	G	A	-0.7219
180	V	A	-0.5040
181	E	A	-1.4097
182	T	A	-0.4717
183	T	A	-0.4891
184	T	A	-0.3200
185	P	A	-0.6272
186	S	A	-1.4320
187	K	A	-3.0069
188	Q	A	-2.8580
189	S	A	-2.0524
190	N	A	-2.7437
191	N	A	-3.0382
192	K	A	-2.6289
193	Y	A	-1.7697
194	A	A	-0.8889
195	A	A	0.0000
196	S	A	0.2686
197	S	A	0.0000
198	Y	A	0.4944
199	L	A	0.0000
200	S	A	-0.5716
201	L	A	-1.1308
202	T	A	-1.9250
203	P	A	0.0000
204	E	A	-3.3025
205	Q	A	-2.4275
206	W	A	0.0000
207	K	A	-3.2057
208	S	A	-2.4872
209	H	A	-2.4376
210	R	A	-2.5164
211	S	A	-1.5016
212	Y	A	0.0000
213	S	A	-1.0073
214	C	A	0.0000
215	Q	A	-1.0730
216	V	A	0.0000
217	T	A	-0.4040
218	H	A	0.0000
219	E	A	-1.0604
220	G	A	-0.8599
221	S	A	-0.5168
222	T	A	-0.4945
223	V	A	-0.6099
224	E	A	-2.0554
225	K	A	-1.5800
226	T	A	-0.7734
227	V	A	-0.0905
228	A	A	-0.8652
229	P	A	-1.3367
230	T	A	-0.9968
231	E	A	-1.5407
232	C	A	-0.1862