Project name: 43c963bd872b406

Status: done

Started: 2026-07-01 15:23:56
Settings
Chain sequence(s) B: SITEQLSWSITLTEEGEQLTLIATSTPESFENREEALKVALSDPVTVVSS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:20)
Show buried residues

Minimal score value
-3.9027
Maximal score value
1.7429
Average score
-0.6341
Total score value
-31.7058

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B 0.5218
2 I B 1.4108
3 T B -0.2771
4 E B -1.6146
5 Q B -1.2710
6 L B 0.7920
7 S B 0.6057
8 W B 1.3562
9 S B 0.5487
10 I B 0.8155
11 T B 0.0462
12 L B -0.5698
13 T B -1.3846
14 E B -3.0422
15 E B -3.0956
16 G B -1.9702
17 E B -1.9991
18 Q B -0.9864
19 L B 0.7298
20 T B 1.0377
21 L B 1.0728
22 I B 0.6749
23 A B 1.0018
24 T B 0.2406
25 S B -0.2286
26 T B -0.5552
27 P B -1.1717
28 E B -2.1387
29 S B -1.5723
30 F B -2.1368
31 E B -3.0485
32 N B -3.2567
33 R B -3.7935
34 E B -3.9027
35 E B -3.4918
36 A B 0.0000
37 L B -1.7284
38 K B -2.1118
39 V B -0.2356
40 A B -0.4465
41 L B 0.6727
42 S B -0.0368
43 D B -1.1401
44 P B 0.2889
45 V B 1.7429
46 T B 1.2189
47 V B 1.4463
48 V B 0.9712
49 S B -0.7921
50 S B -0.9028
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018