Project name: 43e6c3ec5b1a4

Status: done

Started: 2026-04-16 11:57:25
Settings
Chain sequence(s) A: PPIPMTSAFGPAEMNALMTAAMKKMWAIVRPWMQAGIVRGLPEKTIERLKNGPVYGPEEVTVGEVMFVLWTVEHDVVQSMDYHRHWGKMYMLNKQIKRVMRKTMKKIYEANMAAA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:05)
Show buried residues

Minimal score value
-3.9863
Maximal score value
2.1108
Average score
-0.8126
Total score value
-93.4501

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A -0.2633
2 P A 0.0333
3 I A 0.2861
4 P A 0.6482
5 M A 0.8765
6 T A 0.0039
7 S A 0.0001
8 A A -0.3308
9 F A -0.8020
10 G A -1.3920
11 P A -1.3425
12 A A -0.7323
13 E A -1.8005
14 M A 0.0000
15 N A -0.2505
16 A A -0.3919
17 L A -0.5014
18 M A 0.0000
19 T A -1.0871
20 A A -1.1089
21 A A 0.0000
22 M A 0.0000
23 K A -2.6942
24 K A -2.3936
25 M A 0.0000
26 W A -1.7674
27 A A -1.2252
28 I A -0.7186
29 V A 0.0000
30 R A -1.5318
31 P A -1.0741
32 W A -0.9484
33 M A -1.3490
34 Q A -1.7102
35 A A -0.8644
36 G A -0.9819
37 I A -0.9644
38 V A 0.0000
39 R A -2.3820
40 G A -1.8118
41 L A 0.0000
42 P A -2.0201
43 E A -3.1310
44 K A -3.2956
45 T A 0.0000
46 I A -2.3876
47 E A -3.5518
48 R A -2.4078
49 L A 0.0000
50 K A -2.9516
51 N A -2.3255
52 G A 0.0000
53 P A 0.0687
54 V A 1.4658
55 Y A 0.0406
56 G A -0.8469
57 P A -1.5074
58 E A -2.9346
59 E A -2.8239
60 V A 0.0000
61 T A -0.6302
62 V A 0.0000
63 G A 0.0678
64 E A -0.1896
65 V A 0.0000
66 M A 1.3756
67 F A 2.1108
68 V A 0.0000
69 L A 0.0000
70 W A 1.6997
71 T A 1.0205
72 V A 0.0000
73 E A 0.0000
74 H A -0.3901
75 D A -0.5566
76 V A 0.0000
77 V A -0.0373
78 Q A -1.4189
79 S A -1.2895
80 M A 0.0000
81 D A -1.2888
82 Y A 0.1498
83 H A -1.2283
84 R A -2.0745
85 H A -0.7687
86 W A 0.7889
87 G A 0.3397
88 K A -0.2418
89 M A 0.0000
90 Y A 1.4087
91 M A 0.6329
92 L A 0.0000
93 N A -0.5885
94 K A -1.3423
95 Q A -1.5685
96 I A 0.0000
97 K A -2.5144
98 R A -3.5731
99 V A 0.0000
100 M A -2.1843
101 R A -3.9863
102 K A -3.9609
103 T A 0.0000
104 M A -2.2286
105 K A -3.6669
106 K A -3.2640
107 I A 0.0000
108 Y A -1.5067
109 E A -2.3385
110 A A -1.1162
111 N A 0.0000
112 M A -0.1075
113 A A -0.1006
114 A A 0.0461
115 A A 0.2518
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018