Project name: EPSPS inhibitor (CPP-Link-Inhibitor)

Status: done

Started: 2026-03-26 00:44:18
Settings
Chain sequence(s) A: CYGRKKRRQRRCGGGSRARDGGSGGSQHFYYSVL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)
Show buried residues

Minimal score value
-4.4284
Maximal score value
2.2896
Average score
-1.626
Total score value
-53.6578

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A 0.4727
2 Y A 0.1086
3 G A -1.3484
4 R A -2.9354
5 K A -2.7106
6 K A -3.3399
7 R A -4.4284
8 R A -3.4314
9 Q A -3.0280
10 R A -4.0526
11 R A -3.7515
12 C A -2.3915
13 G A -1.8445
14 G A -1.7290
15 G A -1.4306
16 S A -1.5287
17 R A -2.6125
18 A A -2.3718
19 R A -3.3314
20 D A -2.9697
21 G A -2.0949
22 G A -2.0983
23 S A -2.0257
24 G A -1.3388
25 G A -1.2735
26 S A -1.3472
27 Q A -1.7228
28 H A -0.6724
29 F A 1.0668
30 Y A 1.0631
31 Y A 1.6298
32 S A 1.5211
33 V A 2.2896
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018