Project name: fold_rfinf_1_22024_10_30_13_27_model_2

Status: done

Started: 2026-03-26 11:59:53
Settings
Chain sequence(s) B: AAKEAETQQTYKTILNALKLKVRPVTPEQEAEAKAKAEALSKA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-4.2586
Maximal score value
1.0245
Average score
-1.7047
Total score value
-73.3031

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -1.3764
2 A B -2.0441
3 K B -3.5361
4 E B -3.7114
5 A B -3.0164
6 E B -3.7994
7 T B -2.8388
8 Q B -2.8639
9 Q B -2.9539
10 T B -1.3044
11 Y B -0.0276
12 K B -1.4588
13 T B -0.5824
14 I B 0.9384
15 L B 0.2567
16 N B -1.0457
17 A B 0.2866
18 L B 1.0245
19 K B -0.8090
20 L B 0.5895
21 K B -1.0793
22 V B 0.2289
23 R B -0.9111
24 P B -0.3513
25 V B 0.4347
26 T B -1.0700
27 P B -1.7396
28 E B -3.1800
29 Q B -2.9312
30 E B -3.1678
31 A B -3.0989
32 E B -4.2586
33 A B -3.3263
34 K B -3.7727
35 A B -2.9148
36 K B -3.1569
37 A B -2.2308
38 E B -2.9958
39 A B -1.5808
40 L B -0.2893
41 S B -1.1617
42 K B -1.9448
43 A B -0.5324
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018