Project name: asdd

Chain sequence(s)	A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)

• Minimal score value: -3.9349
• Maximal score value: 3.1118
• Average score: -0.8835
• Total score value: -123.6896

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.8589
2	D	A	0.1268
3	V	A	1.8586
4	F	A	2.0308
5	M	A	0.9191
6	K	A	-0.7746
7	G	A	-0.5701
8	L	A	-0.3400
9	S	A	-1.8750
10	K	A	-2.7887
11	A	A	-1.7114
12	K	A	-2.0194
13	E	A	-2.1950
14	G	A	-0.6921
15	V	A	0.8987
16	V	A	0.8283
17	A	A	-0.5670
18	A	A	-0.8582
19	A	A	-1.1137
20	E	A	-2.9494
21	K	A	-3.1911
22	T	A	-2.1034
23	K	A	-3.2782
24	Q	A	-3.1483
25	G	A	-1.8129
26	V	A	-0.2529
27	A	A	-1.3673
28	E	A	-2.5344
29	A	A	-1.4055
30	A	A	-1.4977
31	G	A	-2.5400
32	K	A	-3.1959
33	T	A	-2.2311
34	K	A	-2.8310
35	E	A	-1.9943
36	G	A	-0.5797
37	V	A	1.4959
38	L	A	1.9469
39	Y	A	1.9471
40	V	A	0.6447
41	G	A	-0.4830
42	S	A	-1.0905
43	K	A	-2.1511
44	T	A	-1.8823
45	K	A	-2.6644
46	E	A	-2.5753
47	G	A	-1.5582
48	V	A	-0.1876
49	V	A	0.6556
50	H	A	-0.1420
51	G	A	0.7041
52	V	A	2.3723
53	A	A	0.8975
54	T	A	0.4058
55	V	A	0.8489
56	A	A	-0.7618
57	E	A	-2.8445
58	K	A	-3.2556
59	T	A	-2.3470
60	K	A	-3.5922
61	E	A	-3.9349
62	Q	A	-2.7268
63	V	A	-0.2626
64	T	A	-1.4311
65	N	A	-1.4139
66	V	A	0.7830
67	G	A	0.5883
68	G	A	0.7525
69	A	A	1.6567
70	V	A	3.1118
71	V	A	3.0506
72	T	A	1.9769
73	G	A	2.1610
74	V	A	2.9696
75	T	A	1.4702
76	A	A	0.9251
77	V	A	1.3363
78	A	A	0.3327
79	Q	A	-1.1657
80	K	A	-1.5472
81	T	A	-0.6799
82	V	A	0.0318
83	E	A	-1.7263
84	G	A	-0.9857
85	A	A	0.0925
86	G	A	-0.1845
87	S	A	0.3192
88	I	A	1.4854
89	A	A	0.9223
90	A	A	1.2356
91	A	A	1.2745
92	T	A	1.0202
93	G	A	0.9125
94	F	A	1.8629
95	V	A	1.1823
96	K	A	-1.7131
97	K	A	-2.7409
98	D	A	-3.0747
99	Q	A	-2.2090
100	L	A	-0.6707
101	G	A	-1.6529
102	K	A	-2.9237
103	N	A	-3.5657
104	E	A	-3.8963
105	E	A	-3.7178
106	G	A	-2.2185
107	A	A	-1.7389
108	P	A	-1.9031
109	Q	A	-2.6203
110	E	A	-2.6289
111	G	A	-1.0035
112	I	A	1.0854
113	L	A	0.2910
114	E	A	-1.6807
115	D	A	-1.4395
116	M	A	0.1851
117	P	A	-0.1150
118	V	A	0.0397
119	D	A	-2.1361
120	P	A	-2.3244
121	D	A	-2.9545
122	N	A	-2.5721
123	E	A	-2.6475
124	A	A	-1.2287
125	Y	A	-0.3114
126	E	A	-1.9881
127	M	A	-0.8162
128	P	A	-1.2850
129	S	A	-1.6614
130	E	A	-2.7938
131	E	A	-2.7542
132	G	A	-2.0398
133	Y	A	-0.6750
134	Q	A	-1.8112
135	D	A	-2.2074
136	Y	A	-1.0889
137	E	A	-2.3465
138	P	A	-1.8129
139	E	A	-2.0778
140	A	A	-1.1262