Project name: obj1 [mutate: VG5C, EL6C, GA10C, LC11C, LA45C, ID93C, YH95C, WE110C, GI113C, TP117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	ID93C,LA45C,YH95C,TP117C,LC11C,GA10C,GI113C,EL6C,VG5C,WE110C
Energy difference between WT (input) and mutated protein (by FoldX)	27.2057 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:06)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)

• Minimal score value: -3.23
• Maximal score value: 1.5417
• Average score: -0.8151
• Total score value: -97.8156

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0229
2	V	C	-1.2800
3	Q	C	-2.0431
4	L	C	0.0000
5	G	C	-0.9783	mutated: VG5C
6	L	C	-0.2578	mutated: EL6C
7	S	C	-0.4598
8	G	C	-0.6643
9	G	C	-0.0132
10	A	C	0.6725	mutated: GA10C
11	C	C	0.7304	mutated: LC11C
12	V	C	-0.3624
13	Q	C	-1.5294
14	P	C	-1.5854
15	G	C	-1.4106
16	G	C	-1.0612
17	S	C	-1.2310
18	L	C	-1.0046
19	R	C	-2.1321
20	L	C	0.0000
21	S	C	-0.6531
22	C	C	0.0000
23	A	C	-0.6227
24	A	C	0.0000
25	S	C	-0.4044
26	D	C	0.0000
27	F	C	1.5417
28	T	C	0.2492
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.0727
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-1.1810
40	A	C	-1.5142
41	P	C	-1.4591
42	G	C	-1.5733
43	K	C	-2.4386
44	G	C	-1.7123
45	A	C	-1.1047	mutated: LA45C
46	E	C	-1.0384
47	W	C	0.0133
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3561
61	A	C	-1.1377
62	D	C	-2.3439
63	S	C	-1.7142
64	V	C	0.0000
65	K	C	-2.3844
66	G	C	-1.6174
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3148
77	N	C	-1.6456
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6265
81	L	C	0.0000
82	Q	C	-1.2357
83	M	C	0.0000
84	N	C	-1.3345
85	S	C	-1.2332
86	L	C	0.0000
87	R	C	-2.4840
88	A	C	-1.9123
89	E	C	-2.3563
90	D	C	0.0000
91	T	C	-0.7516
92	A	C	0.0000
93	D	C	-0.0363	mutated: ID93C
94	Y	C	0.0000
95	H	C	0.0000	mutated: YH95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.9584
101	D	C	-3.2300
102	G	C	-2.0087
103	F	C	-1.1470
104	N	C	-2.3440
105	K	C	-3.0430
106	G	C	-1.5852
107	F	C	-0.8106
108	D	C	-1.3447
109	Y	C	-1.2498
110	E	C	-1.9669	mutated: WE110C
111	G	C	-1.5575
112	Q	C	-1.6452
113	I	C	-0.2704	mutated: GI113C
114	T	C	0.3898
115	L	C	1.3001
116	V	C	0.0000
117	P	C	-0.1102	mutated: TP117C
118	V	C	0.0000
119	S	C	-0.9921
120	S	C	-1.0922