Project name: 44be25fcf8993bc

Chain sequence(s)	A: AALAAYRTALAAVRAAAAAFMAAVRADLGDSPAVQALEALAAQLDATTAALVAALDARRWDEALALQAQVAALVAQQVAALDAIVAGLSAAAQAAYAALVAARAATAAAAAALVAAIRAL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)

• Minimal score value: -2.9345
• Maximal score value: 1.0967
• Average score: -0.3876
• Total score value: -46.5143

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	0.0963
2	A	A	0.1674
3	L	A	0.0319
4	A	A	-0.0836
5	A	A	-0.0938
6	Y	A	0.0000
7	R	A	-0.7325
8	T	A	-0.3317
9	A	A	-0.2933
10	L	A	-0.4009
11	A	A	-0.5036
12	A	A	-0.3505
13	V	A	-0.2269
14	R	A	-1.2923
15	A	A	-0.4652
16	A	A	-0.0767
17	A	A	-0.1900
18	A	A	-0.1787
19	A	A	0.0300
20	F	A	0.0000
21	M	A	-0.1550
22	A	A	-0.2404
23	A	A	-0.3457
24	V	A	0.0000
25	R	A	-1.4244
26	A	A	-0.8661
27	D	A	-1.2380
28	L	A	-0.7258
29	G	A	-1.5284
30	D	A	-2.4561
31	S	A	-1.4498
32	P	A	-1.1125
33	A	A	-0.8024
34	V	A	0.0000
35	Q	A	-1.9631
36	A	A	-0.8892
37	L	A	0.0000
38	E	A	-1.0564
39	A	A	-0.6296
40	L	A	-0.5307
41	A	A	-0.6373
42	A	A	-0.5576
43	Q	A	-0.9400
44	L	A	-0.6658
45	D	A	-1.0179
46	A	A	-0.4713
47	T	A	0.0000
48	T	A	-0.2226
49	A	A	-0.0273
50	A	A	-0.0767
51	L	A	0.0000
52	V	A	-0.3280
53	A	A	-0.6694
54	A	A	0.0000
55	L	A	0.0000
56	D	A	-1.6846
57	A	A	-1.6719
58	R	A	-2.9345
59	R	A	-2.7573
60	W	A	-1.9246
61	D	A	-2.6113
62	E	A	-1.9022
63	A	A	0.0000
64	L	A	-0.7245
65	A	A	-0.4973
66	L	A	-0.2731
67	Q	A	-0.2357
68	A	A	-0.0808
69	Q	A	-0.4964
70	V	A	0.0000
71	A	A	-0.0691
72	A	A	-0.1013
73	L	A	-0.1298
74	V	A	0.2929
75	A	A	0.0500
76	Q	A	-0.6582
77	Q	A	-0.1651
78	V	A	0.3668
79	A	A	-0.3589
80	A	A	-0.3655
81	L	A	0.0000
82	D	A	-1.4505
83	A	A	-0.5511
84	I	A	-0.1974
85	V	A	-0.2641
86	A	A	-0.3791
87	G	A	-0.4246
88	L	A	0.0000
89	S	A	-0.4078
90	A	A	-0.1518
91	A	A	-0.1757
92	A	A	0.0000
93	Q	A	-0.4185
94	A	A	0.0055
95	A	A	0.1764
96	Y	A	0.3925
97	A	A	0.3677
98	A	A	0.4148
99	L	A	0.0000
100	V	A	1.0967
101	A	A	0.5619
102	A	A	0.2429
103	R	A	0.1805
104	A	A	0.3072
105	A	A	0.2564
106	T	A	0.1111
107	A	A	0.1408
108	A	A	0.1714
109	A	A	0.1034
110	A	A	0.0000
111	A	A	0.2730
112	A	A	0.1227
113	L	A	0.0000
114	V	A	0.1443
115	A	A	-0.1107
116	A	A	0.0443
117	I	A	0.0000
118	R	A	-1.2892
119	A	A	0.0010
120	L	A	1.0457