Project name: C1Q_Alpha

Status: done

Started: 2026-06-24 13:34:15
Settings
Chain sequence(s) A: MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)
Show buried residues

Minimal score value
-3.9445
Maximal score value
4.3831
Average score
-0.5498
Total score value
-133.6084

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7469
2 R A -0.4068
3 P A 0.9323
4 L A 2.9794
5 L A 2.9211
6 V A 3.1880
7 L A 4.1104
8 L A 4.3831
9 L A 4.3792
10 L A 3.8920
11 G A 2.4681
12 L A 2.6997
13 A A 1.4961
14 A A 0.5811
15 G A -0.0844
16 S A -0.0545
17 P A -0.5020
18 P A -0.5542
19 L A -0.2919
20 D A -2.7114
21 D A -3.0980
22 N A -2.6337
23 K A -2.3247
24 I A 0.6148
25 P A 0.4493
26 S A 0.7449
27 L A 2.4275
28 C A 0.9870
29 P A 0.0803
30 G A -1.0659
31 H A -1.3918
32 P A -0.8502
33 G A -0.5213
34 L A 0.8187
35 P A 0.0044
36 G A -0.5925
37 T A -0.5735
38 P A -1.0608
39 G A -2.0440
40 H A -1.9595
41 H A -2.3417
42 G A -2.1350
43 S A -1.3498
44 Q A -1.5223
45 G A -0.8785
46 L A 0.5412
47 P A -0.6609
48 G A -1.7244
49 R A -3.1620
50 D A -3.7223
51 G A -3.2765
52 R A -3.9445
53 D A -3.9169
54 G A -3.2609
55 R A -3.6621
56 D A -3.3012
57 G A -1.8471
58 A A -1.0015
59 P A -0.8756
60 G A -0.6680
61 A A -0.4478
62 P A -1.3242
63 G A -2.0038
64 E A -3.2502
65 K A -3.4806
66 G A -2.8795
67 E A -3.2362
68 G A -2.4529
69 G A -2.2304
70 R A -2.4509
71 P A -1.2030
72 G A -0.4967
73 L A 0.7349
74 P A -0.1996
75 G A -0.9567
76 P A -1.5816
77 R A -2.8480
78 G A -2.6793
79 D A -2.7593
80 P A -2.1171
81 G A -2.1454
82 P A -2.0610
83 R A -2.9818
84 G A -2.8248
85 E A -2.6909
86 A A -1.6028
87 G A -1.3233
88 P A -0.8632
89 A A -0.5836
90 G A -0.7610
91 P A -0.7467
92 T A -0.8434
93 G A -1.2076
94 P A -1.0201
95 A A -0.8316
96 G A -1.1528
97 E A -1.4101
98 C A 0.5352
99 S A 0.7203
100 V A 1.2359
101 P A 0.3053
102 P A -0.5408
103 R A -1.5468
104 S A 0.0000
105 A A 0.0255
106 F A 0.0000
107 S A 0.9827
108 A A 0.0000
109 K A -1.5504
110 R A -1.9058
111 S A -2.0962
112 E A -1.9805
113 S A -1.3734
114 R A -1.4592
115 V A 0.4587
116 P A -0.0085
117 P A 0.0000
118 P A -0.6132
119 S A -1.3882
120 D A -2.0717
121 A A -1.1576
122 P A -0.5258
123 L A 0.0000
124 P A -0.6973
125 F A 0.0000
126 D A -1.6101
127 R A -1.3989
128 V A 0.7101
129 L A 1.7500
130 V A 1.4437
131 N A -0.3472
132 E A -1.9784
133 Q A -1.8169
134 G A -1.4717
135 H A -1.3075
136 Y A 0.0000
137 D A -0.8992
138 A A -0.5971
139 V A 0.7878
140 T A 0.1514
141 G A 0.0000
142 K A -0.6077
143 F A 0.0000
144 T A -1.7065
145 C A 0.0000
146 Q A -1.9908
147 V A 0.0000
148 P A 0.0000
149 G A 0.0000
150 V A 0.5604
151 Y A 0.0000
152 Y A 1.6921
153 F A 0.0000
154 A A 0.0607
155 V A 0.0000
156 H A -1.3072
157 A A 0.0000
158 T A 0.0000
159 V A 0.0000
160 Y A -0.7731
161 R A -1.8622
162 A A -0.5959
163 S A 0.5632
164 L A 0.0000
165 Q A 0.9692
166 F A 0.0000
167 D A -0.4819
168 L A 0.0000
169 V A 0.0000
170 K A -1.8924
171 N A -2.5528
172 G A -2.3155
173 E A -2.5112
174 S A -1.3521
175 I A -0.1706
176 A A -0.0466
177 S A 0.2276
178 F A 0.8947
179 F A 2.3216
180 Q A 1.6608
181 F A 2.2530
182 F A 0.6467
183 G A -0.0118
184 G A -0.7170
185 W A -0.5823
186 P A -1.1381
187 K A -1.8917
188 P A -1.0747
189 A A -0.3205
190 S A -0.3397
191 L A 0.0000
192 S A -0.3992
193 G A -0.1377
194 G A 0.0427
195 A A 0.6752
196 M A 1.4227
197 V A 0.5523
198 R A -0.9663
199 L A 0.0000
200 E A -2.9083
201 P A -2.2801
202 E A -2.8633
203 D A -2.5023
204 Q A -1.9365
205 V A 0.0000
206 W A 0.0000
207 V A 0.0000
208 Q A -0.8318
209 V A 0.0000
210 G A -0.8423
211 V A -0.1662
212 G A -1.1611
213 D A -1.4703
214 Y A 0.2286
215 I A -0.2104
216 G A 0.0000
217 I A 0.0000
218 Y A -0.8871
219 A A 0.0000
220 S A -0.5910
221 I A 0.5989
222 K A -1.0850
223 T A -1.1991
224 D A -1.9980
225 S A 0.0000
226 T A -0.8689
227 F A 0.0000
228 S A 0.5331
229 G A 0.0000
230 F A 1.7224
231 L A 1.3682
232 V A 2.0071
233 Y A 1.3187
234 S A -0.5630
235 D A -1.5583
236 W A -0.5530
237 H A -1.1506
238 S A -0.3441
239 S A 0.4872
240 P A 1.0768
241 V A 2.9554
242 F A 2.6022
243 A A 1.3419
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018