Project name: 4612f8b9bc53729

Status: done

Started: 2026-06-26 11:14:45
Settings
Chain sequence(s) A: MSHHHHHHSGMDLFEELLKVAEELAEWAKSNLPIKTKEEAEKLAEFIVRMIKIIADYLGYKGEIVVKAYYEPDENGTVHPLGKEIAELIEELGKKEFGKDTKGEKYYVEVFVMIEKDGIAFELYFQIGEDQWLIVHVRITEESVTLTIVKDGEMKTKVIPIKNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:59)
Show buried residues

Minimal score value
-3.8969
Maximal score value
0.7633
Average score
-1.287
Total score value
-211.0602

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5501
2 S A -0.6303
3 H A -1.7438
4 H A -2.3620
5 H A -2.7642
6 H A -2.8016
7 H A -2.5760
8 H A -2.2412
9 S A -1.3590
10 G A -1.1743
11 M A -0.8029
12 D A -1.5463
13 L A 0.0000
14 F A -1.3869
15 E A -2.2105
16 E A -1.7927
17 L A 0.0000
18 L A -1.9605
19 K A -2.6998
20 V A 0.0000
21 A A 0.0000
22 E A -3.0857
23 E A -2.8544
24 L A 0.0000
25 A A 0.0000
26 E A -3.2371
27 W A -1.6278
28 A A 0.0000
29 K A -2.5379
30 S A -1.2277
31 N A -1.4270
32 L A -1.4255
33 P A -1.7935
34 I A 0.0000
35 K A -2.3598
36 T A -2.4067
37 K A -3.1533
38 E A -3.3497
39 E A 0.0000
40 A A 0.0000
41 E A -3.1220
42 K A -2.6159
43 L A 0.0000
44 A A 0.0000
45 E A -2.4562
46 F A -1.5145
47 I A 0.0000
48 V A 0.0000
49 R A -1.5630
50 M A 0.0000
51 I A 0.0000
52 K A -1.2917
53 I A -0.8059
54 I A 0.0000
55 A A 0.0000
56 D A -1.6023
57 Y A -0.1139
58 L A -0.0596
59 G A -0.7100
60 Y A -1.3135
61 K A -2.6279
62 G A -2.8364
63 E A -2.4557
64 I A -1.1122
65 V A -0.0734
66 V A 0.0000
67 K A -1.1554
68 A A 0.0000
69 Y A -0.5024
70 Y A -0.7715
71 E A -1.6057
72 P A -1.3464
73 D A -2.1021
74 E A -2.9587
75 N A -2.2971
76 G A -1.6286
77 T A -0.8309
78 V A 0.7633
79 H A -0.4962
80 P A -0.5157
81 L A -1.3114
82 G A 0.0000
83 K A -2.4060
84 E A -2.6711
85 I A 0.0000
86 A A 0.0000
87 E A -3.3667
88 L A 0.0000
89 I A 0.0000
90 E A -3.3674
91 E A -3.8264
92 L A -3.1741
93 G A 0.0000
94 K A -3.8969
95 K A -3.7777
96 E A -3.0747
97 F A 0.0000
98 G A -2.7745
99 K A -3.3778
100 D A -3.3886
101 T A -2.4869
102 K A -3.0164
103 G A -3.0282
104 E A -3.0943
105 K A -2.0065
106 Y A -0.3606
107 Y A 0.6087
108 V A 0.0000
109 E A -0.2050
110 V A 0.0000
111 F A 0.1925
112 V A 0.0000
113 M A -0.5271
114 I A 0.0000
115 E A -2.3756
116 K A -2.8847
117 D A -3.3805
118 G A 0.0000
119 I A 0.0000
120 A A 0.0000
121 F A 0.0000
122 E A -0.1768
123 L A 0.0000
124 Y A 0.3959
125 F A 0.0000
126 Q A -0.8944
127 I A -0.6876
128 G A -1.5894
129 E A -2.9017
130 D A -2.9539
131 Q A -2.4010
132 W A -0.9189
133 L A 0.0000
134 I A 0.3276
135 V A 0.0000
136 H A -0.3336
137 V A 0.0000
138 R A -1.0718
139 I A 0.0000
140 T A -2.6045
141 E A -3.6635
142 E A -3.4620
143 S A -2.2165
144 V A 0.0000
145 T A -0.6095
146 L A 0.0000
147 T A -0.1523
148 I A 0.0000
149 V A -0.3433
150 K A -1.5879
151 D A -2.5060
152 G A -2.0104
153 E A -2.3027
154 M A -0.4816
155 K A -0.8509
156 T A -0.3204
157 K A -0.5541
158 V A 0.2354
159 I A 0.0000
160 P A -1.8787
161 I A 0.0000
162 K A -3.3797
163 N A -3.1183
164 S A -1.3603
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018