Project name: 46bf9f601ecd0f4

Status: done

Started: 2026-07-01 15:24:47
Settings
Chain sequence(s) B: APQSVRLAWLSRGPLEKKGQRVAESTVIGAGLQAVSISVSGGTLTVTLRL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)
Show buried residues

Minimal score value
-3.4048
Maximal score value
2.5398
Average score
-0.2446
Total score value
-12.2317

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -0.1990
2 P B -0.0841
3 Q B -0.7307
4 S B -0.1173
5 V B -0.3396
6 R B -1.8277
7 L B -0.9415
8 A B -0.6277
9 W B 0.6593
10 L B 0.1982
11 S B -1.0262
12 R B -2.7338
13 G B -1.6172
14 P B -0.4519
15 L B 0.0933
16 E B -2.2129
17 K B -3.0118
18 K B -3.4048
19 G B -2.5975
20 Q B -2.2436
21 R B -1.6016
22 V B 0.5520
23 A B -0.2335
24 E B -1.8627
25 S B -1.1724
26 T B -0.5683
27 V B 0.7083
28 I B 1.6268
29 G B 0.7013
30 A B 0.0037
31 G B -0.3143
32 L B 0.0183
33 Q B -0.9743
34 A B 0.2827
35 V B 1.1689
36 S B 1.0693
37 I B 2.5398
38 S B 1.7289
39 V B 2.1032
40 S B 0.4030
41 G B -0.3137
42 G B -0.2363
43 T B 0.4197
44 L B 1.6805
45 T B 1.3598
46 V B 1.5810
47 T B 0.4935
48 L B 0.1775
49 R B -1.0190
50 L B 0.6627
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018