Project name: Mb5-11_LLFFFL

Status: done

Started: 2026-07-06 06:28:33
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPFSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)
Show buried residues

Minimal score value
-2.9165
Maximal score value
1.475
Average score
-0.744
Total score value
-81.0928

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3578
2 Q A -1.0094
3 A A -1.0930
4 N A -1.9871
5 S A -1.3465
6 G A -1.5462
7 S A -1.2497
8 L A 0.0000
9 E A -1.8032
10 V A -0.4188
11 V A 0.0630
12 E A -1.3732
13 A A -1.0548
14 S A -1.3285
15 P A -1.9211
16 T A -1.2669
17 S A -1.1486
18 L A 0.0000
19 Q A -0.7169
20 L A 0.0000
21 S A -1.1287
22 W A 0.0000
23 D A -2.5621
24 A A -1.5622
25 F A 0.0000
26 H A -1.2568
27 R A -0.3581
28 Y A 0.8315
29 H A 0.2196
30 N A -0.5878
31 G A 0.1227
32 F A 1.4750
33 T A 0.6911
34 H A 0.0000
35 P A -0.3455
36 V A -0.8384
37 R A -1.0260
38 Y A -0.6913
39 Y A 0.0000
40 R A -0.8211
41 L A 0.0000
42 T A 0.0000
43 Y A -0.3645
44 G A 0.0000
45 E A -1.8149
46 T A -1.4834
47 G A -1.3815
48 G A -1.5056
49 N A -1.5420
50 S A -0.9330
51 P A -0.4071
52 V A 0.3094
53 Q A -1.1790
54 E A -1.7785
55 F A -0.6861
56 T A -0.2623
57 V A 0.0000
58 P A -0.8868
59 G A -1.0521
60 S A -1.0599
61 K A -1.4888
62 S A -1.2024
63 T A -0.7703
64 A A 0.0000
65 T A -0.3042
66 F A 0.0000
67 S A -0.7515
68 G A -0.9997
69 L A 0.0000
70 K A -2.5536
71 P A -2.1546
72 G A -1.4653
73 V A -1.5376
74 D A -2.9165
75 Y A 0.0000
76 T A -0.8879
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2816
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6842
85 Y A 0.0000
86 P A -0.4446
87 R A -1.1121
88 Y A 0.6939
89 G A 0.6736
90 Y A 1.0973
91 G A 0.3171
92 E A -0.6798
93 S A 0.0000
94 G A -0.6081
95 P A -0.4707
96 F A -0.0834
97 S A -0.3165
98 L A -0.6809
99 N A -1.6487
100 Y A -1.4192
101 R A -2.3951
102 T A 0.0000
103 E A -2.5568
104 L A -1.3573
105 D A -2.8064
106 K A -2.8522
107 P A -1.8062
108 S A -1.6370
109 Q A -1.6614
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018