Project name: query_structure

Status: done

Started: 2026-03-17 00:38:05
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVEAFHMRWYRQAPGKEREWVAAITSKGQHTFYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDYGMWFMYYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:57)
Show buried residues

Minimal score value
-3.6771
Maximal score value
2.5233
Average score
-0.6667
Total score value
-79.9984

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.5221
2 V A -0.9702
3 Q A -0.9621
4 L A 0.0000
5 V A 0.9313
6 E A 0.0000
7 S A -0.6423
8 G A -1.0775
9 G A -0.8375
10 G A -0.0475
11 L A 1.0040
12 V A -0.0258
13 Q A -1.2500
14 A A -1.4454
15 G A -1.3549
16 G A -0.8861
17 S A -1.2211
18 L A -0.9203
19 R A -2.1736
20 L A 0.0000
21 S A -0.5381
22 C A 0.0000
23 A A -0.2190
24 A A 0.0000
25 S A -0.7803
26 G A -1.1191
27 F A 0.0000
28 P A -0.8362
29 V A 0.0000
30 E A -1.6922
31 A A -0.9099
32 F A 0.0000
33 H A -0.8981
34 M A 0.0000
35 R A -0.1421
36 W A 0.0000
37 Y A -0.4849
38 R A -1.2906
39 Q A -2.2317
40 A A -2.1182
41 P A -1.4838
42 G A -2.0004
43 K A -3.4372
44 E A -3.6771
45 R A -2.9859
46 E A -1.8522
47 W A -0.5724
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 T A -1.3167
53 S A -1.6576
54 K A -2.6604
55 G A -2.2583
56 Q A -2.2259
57 H A -1.6780
58 T A -0.3216
59 F A 0.4179
60 Y A -0.3610
61 A A -1.0895
62 D A -2.3230
63 S A -1.7885
64 V A 0.0000
65 K A -2.5001
66 G A -1.7978
67 R A -1.5256
68 F A 0.0000
69 T A -0.7517
70 I A 0.0000
71 S A -0.7860
72 R A -1.9127
73 D A -2.0574
74 N A -2.2692
75 A A -1.5883
76 K A -2.3610
77 N A -1.8735
78 T A 0.0000
79 V A 0.0000
80 Y A 0.0000
81 L A 0.0000
82 Q A -1.2727
83 M A 0.0000
84 N A -1.4466
85 S A -1.2468
86 L A 0.0000
87 K A -2.4313
88 P A -1.9621
89 E A -2.3860
90 D A 0.0000
91 T A -1.0061
92 A A 0.0000
93 V A -0.7022
94 Y A 0.0000
95 Y A -0.2502
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -0.5161
100 D A 0.5680
101 Y A 1.6166
102 G A 1.3303
103 M A 2.1119
104 W A 2.2567
105 F A 2.2339
106 M A 2.5233
107 Y A 2.3874
108 Y A 1.4500
109 D A -0.4006
110 Y A -0.1300
111 W A 0.0449
112 G A -0.1890
113 Q A -0.9347
114 G A 0.0000
115 T A 0.0000
116 Q A -1.1945
117 V A 0.0000
118 T A -0.3277
119 V A 0.0000
120 S A -0.7684
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018