Project name: 47f78b5566a5ce5

Chain sequence(s)	A: LTTYTATTTLWGHTLTCQVQQLGTTVTGQLLFDGQPMQGAETTYDSAKNQVTVTLNFEVDEQPVTVTCVLDMTTQKATFTVAHPGSKQVFVDTADVTVTS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:07)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:42)

• Minimal score value: -3.0336
• Maximal score value: 2.1929
• Average score: -0.5643
• Total score value: -56.4306

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	L	A	1.7215
2	T	A	0.8852
3	T	A	0.3648
4	Y	A	-0.2325
5	T	A	-0.5016
6	A	A	0.0000
7	T	A	-0.3837
8	T	A	0.0000
9	T	A	-0.2173
10	L	A	0.5446
11	W	A	0.8216
12	G	A	-0.2977
13	H	A	-0.6783
14	T	A	-0.6462
15	L	A	0.0000
16	T	A	-0.4786
17	C	A	0.0000
18	Q	A	-0.6762
19	V	A	0.0000
20	Q	A	-0.1672
21	Q	A	0.5776
22	L	A	1.6173
23	G	A	0.4285
24	T	A	0.1384
25	T	A	0.4463
26	V	A	0.3989
27	T	A	-0.4125
28	G	A	-0.9160
29	Q	A	-1.4371
30	L	A	0.0000
31	L	A	-0.7281
32	F	A	-0.4206
33	D	A	-1.5627
34	G	A	-1.3872
35	Q	A	-1.7084
36	P	A	-1.2649
37	M	A	-0.9740
38	Q	A	-1.8633
39	G	A	-1.6550
40	A	A	-1.7187
41	E	A	-2.3120
42	T	A	-0.9560
43	T	A	-0.4605
44	Y	A	-0.3913
45	D	A	-1.3706
46	S	A	-1.2080
47	A	A	-1.2182
48	K	A	-2.2665
49	N	A	-1.7122
50	Q	A	-1.5181
51	V	A	0.0000
52	T	A	-0.3575
53	V	A	0.0000
54	T	A	-1.0102
55	L	A	0.0000
56	N	A	-1.6763
57	F	A	-0.8841
58	E	A	-2.1672
59	V	A	-0.7105
60	D	A	-2.5321
61	E	A	-3.0336
62	Q	A	-2.3869
63	P	A	-1.7077
64	V	A	-0.6736
65	T	A	-0.3877
66	V	A	0.0000
67	T	A	-0.0915
68	C	A	0.0000
69	V	A	0.0846
70	L	A	0.0000
71	D	A	-1.6553
72	M	A	0.0000
73	T	A	-1.0300
74	T	A	-1.2549
75	Q	A	-1.8390
76	K	A	-2.4885
77	A	A	0.0000
78	T	A	-0.2945
79	F	A	0.0000
80	T	A	1.1713
81	V	A	0.0000
82	A	A	0.2543
83	H	A	-0.9818
84	P	A	-1.2211
85	G	A	-1.7043
86	S	A	-1.4527
87	K	A	-2.0242
88	Q	A	-0.9128
89	V	A	1.5969
90	F	A	2.0322
91	V	A	2.1929
92	D	A	0.3402
93	T	A	-0.6104
94	A	A	-1.5498
95	D	A	-2.4575
96	V	A	0.0000
97	T	A	-0.4215
98	V	A	0.3855
99	T	A	0.3797
100	S	A	0.4455