Project name: Mb5-11_IVFFVF

Status: done

Started: 2026-07-06 06:37:06
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQISWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPVSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:15)
Show buried residues

Minimal score value
-2.7915
Maximal score value
1.482
Average score
-0.6933
Total score value
-75.5684

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2430
2 Q A -1.0494
3 A A 0.0000
4 N A -1.9808
5 S A -1.3875
6 G A 0.0000
7 S A -1.1893
8 L A 0.0000
9 E A -1.7732
10 V A -0.3979
11 V A 0.0645
12 E A -1.3788
13 A A -1.1012
14 S A -1.2591
15 P A -1.9411
16 T A -1.2544
17 S A -1.1507
18 L A 0.0000
19 Q A -0.7331
20 I A 0.0000
21 S A -1.0808
22 W A 0.0000
23 D A -2.5313
24 A A -1.5076
25 F A 0.0000
26 H A -1.2249
27 R A 0.0000
28 Y A 0.9216
29 H A 0.2273
30 N A -0.5964
31 G A 0.1359
32 F A 1.4820
33 T A 0.6987
34 H A 0.0836
35 P A -0.3524
36 V A -0.8235
37 R A -1.2914
38 Y A -0.7251
39 Y A 0.0000
40 R A -0.7960
41 V A 0.0000
42 T A -0.6148
43 Y A -0.3437
44 G A 0.0000
45 E A -1.5912
46 T A -1.2374
47 G A -1.2190
48 G A -1.3204
49 N A -1.5278
50 S A -0.9130
51 P A -0.4051
52 V A 0.2951
53 Q A -1.1886
54 E A -1.7403
55 F A -0.5893
56 T A -0.2091
57 V A 0.0000
58 P A -0.8767
59 G A -1.0466
60 S A -0.9579
61 K A -1.3648
62 S A -1.0124
63 T A -0.6867
64 A A 0.0000
65 T A -0.3466
66 F A 0.0000
67 S A -0.7589
68 G A -1.0118
69 L A 0.0000
70 K A -2.4979
71 P A -2.1164
72 G A -1.4760
73 V A -1.3584
74 D A -2.2467
75 Y A 0.0000
76 T A -0.7349
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2673
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.7736
85 Y A 0.0000
86 P A -0.4171
87 R A -1.0890
88 Y A 0.7271
89 G A 0.7420
90 Y A 1.2186
91 G A 0.5309
92 E A -0.4756
93 S A 0.0000
94 G A -0.8613
95 P A -0.4770
96 V A -0.2032
97 S A -0.2576
98 F A -0.3967
99 N A -1.5628
100 Y A -1.5674
101 R A -2.7316
102 T A 0.0000
103 E A -2.5731
104 L A -1.3096
105 D A -2.7403
106 K A -2.7915
107 P A -1.7817
108 S A -1.6323
109 Q A -1.6589
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018