Project name: 49746bb6e12bd82

Status: done

Started: 2026-04-25 16:10:37
Settings
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMGWFRQAPGKGRELVAAINSNGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCASGDYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:49)
Show buried residues

Minimal score value
-2.7646
Maximal score value
1.226
Average score
-0.7529
Total score value
-84.3233

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1501
2 V A -1.1512
3 Q A -1.1129
4 L A 0.0000
5 V A 1.2260
6 E A 0.0000
7 S A -0.4884
8 G A -1.0694
9 G A -0.7911
10 G A -0.0662
11 L A 0.9311
12 V A 0.0000
13 Q A -1.3677
14 P A -1.5602
15 G A -1.4464
16 G A -1.0758
17 S A -1.4177
18 L A -0.9112
19 R A -1.8791
20 L A 0.0000
21 S A -0.2348
22 C A 0.0000
23 A A -0.1471
24 A A 0.0000
25 S A -0.8642
26 G A -1.2298
27 F A -0.4190
28 T A -0.1062
29 F A 0.0000
30 S A -0.7883
31 S A -0.1441
32 Y A 0.5120
33 G A -0.3900
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0839
38 R A 0.0000
39 Q A -1.7592
40 A A -1.7954
41 P A -1.2883
42 G A -1.7231
43 K A -2.7646
44 G A -2.4205
45 R A -2.4253
46 E A -1.3378
47 L A 0.1916
48 V A 0.0000
49 A A 0.0000
50 A A 0.3867
51 I A 0.0000
52 N A -0.9407
53 S A -0.9833
54 N A -1.8384
55 G A -1.5495
56 G A -1.2236
57 S A -0.6500
58 T A 0.2247
59 Y A 0.8694
60 Y A -0.2864
61 P A -1.1142
62 D A -2.4810
63 S A -1.8513
64 V A 0.0000
65 E A -2.6230
66 G A -1.9661
67 R A -1.8870
68 F A 0.0000
69 T A -0.8499
70 I A 0.0000
71 S A -0.5283
72 R A -1.3209
73 D A -1.7042
74 N A -2.0120
75 A A -1.4916
76 K A -2.4416
77 R A -2.1495
78 M A -1.0114
79 V A 0.0000
80 Y A -0.4701
81 L A 0.0000
82 Q A -1.4028
83 M A 0.0000
84 N A -2.0491
85 S A -1.4770
86 L A 0.0000
87 R A -2.1267
88 A A -1.6156
89 E A -2.1696
90 D A 0.0000
91 T A -0.8804
92 A A 0.0000
93 V A -0.7255
94 Y A 0.0000
95 Y A -0.0735
96 C A 0.0000
97 A A 0.0000
98 S A 0.0000
99 G A -0.7904
100 D A -1.4209
101 Y A 0.0365
102 W A 0.3160
103 G A 0.1639
104 Q A -0.8476
105 G A -0.4739
106 T A -0.7524
107 Q A -1.1031
108 V A 0.0000
109 T A -0.3593
110 V A 0.0000
111 S A -0.7669
112 S A -0.5313
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018