Project name: 49f92401207be81

Status: done

Started: 2026-07-08 16:39:25
Settings
Chain sequence(s) A: EQAALIAEAERIAARVRANMAEAEAVIREGDAASQAHLPAFRAQAAELDALTAELLAALRAEDWEAAAATLRRLLAAGEEYIAIMEKAKVPQELIDRARQIRAEGERLLEKLAAAVAAHS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:01)
Show buried residues

Minimal score value
-3.6933
Maximal score value
0.0
Average score
-1.5532
Total score value
-186.3805

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.0887
2 Q A -2.0402
3 A A -1.1243
4 A A -0.8947
5 L A 0.0000
6 I A -1.4816
7 A A -1.2975
8 E A -1.9496
9 A A 0.0000
10 E A -2.7044
11 R A -2.9419
12 I A -1.8533
13 A A -1.6587
14 A A -1.5075
15 R A -1.5019
16 V A -1.2638
17 R A -1.0223
18 A A -0.8020
19 N A 0.0000
20 M A 0.0000
21 A A -0.9146
22 E A -1.6957
23 A A 0.0000
24 E A -1.8968
25 A A -1.5193
26 V A -1.6148
27 I A 0.0000
28 R A -3.2259
29 E A -3.1898
30 G A -2.8862
31 D A -2.9055
32 A A -1.6359
33 A A -1.2340
34 S A -2.4707
35 Q A -2.4943
36 A A -1.1337
37 H A -1.4346
38 L A -1.2051
39 P A -0.9744
40 A A -0.8094
41 F A 0.0000
42 R A -2.1311
43 A A -1.3876
44 Q A -1.6270
45 A A -1.6086
46 A A -1.6109
47 E A -2.2155
48 L A 0.0000
49 D A -2.1550
50 A A -1.5726
51 L A 0.0000
52 T A -1.5399
53 A A -1.4153
54 E A -2.0628
55 L A 0.0000
56 L A -1.1997
57 A A -1.4560
58 A A -2.0414
59 L A 0.0000
60 R A -2.6927
61 A A -2.0674
62 E A -3.4140
63 D A -2.9323
64 W A 0.0000
65 E A -2.3720
66 A A -1.8243
67 A A 0.0000
68 A A -1.7164
69 A A -1.4670
70 T A -1.7804
71 L A 0.0000
72 R A -2.7813
73 R A -2.7716
74 L A -2.4276
75 L A 0.0000
76 A A -2.0238
77 A A 0.0000
78 G A -2.3268
79 E A -2.8014
80 E A -2.5753
81 Y A 0.0000
82 I A 0.0000
83 A A -2.1401
84 I A -2.0504
85 M A 0.0000
86 E A -3.4931
87 K A -2.9995
88 A A 0.0000
89 K A -3.2888
90 V A 0.0000
91 P A -2.1849
92 Q A -3.1905
93 E A -3.3255
94 L A 0.0000
95 I A 0.0000
96 D A -3.6536
97 R A -3.1568
98 A A 0.0000
99 R A -3.6933
100 Q A -2.8079
101 I A 0.0000
102 R A -2.5388
103 A A -2.2133
104 E A -2.4784
105 G A 0.0000
106 E A -3.1706
107 R A -3.4809
108 L A 0.0000
109 L A -2.4803
110 E A -3.1726
111 K A -2.4333
112 L A 0.0000
113 A A -1.1780
114 A A -0.7258
115 A A -1.3816
116 V A -1.0240
117 A A -0.3703
118 A A -0.2857
119 H A -1.3811
120 S A -0.7106
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018