Project name: Mb5-11_I18L_I104L_LIFFVF_Lib3_Top1

Status: done

Started: 2026-07-06 06:59:20
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRITYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPVSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)
Show buried residues

Minimal score value
-3.0313
Maximal score value
1.508
Average score
-0.7372
Total score value
-80.3503

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2539
2 Q A -1.0198
3 A A 0.0000
4 N A -1.9632
5 S A -1.4828
6 G A 0.0000
7 S A -1.1854
8 L A 0.0000
9 E A -1.7610
10 V A -0.3552
11 V A 0.1172
12 E A -1.3473
13 A A -0.8109
14 S A -1.1121
15 P A -1.6378
16 T A -1.1559
17 S A -1.0685
18 L A 0.0000
19 Q A -0.7047
20 L A 0.0000
21 S A -1.1212
22 W A 0.0000
23 D A -2.5689
24 A A -1.5795
25 F A 0.0000
26 H A -1.2365
27 R A 0.0000
28 Y A 0.9269
29 H A 0.2711
30 N A -0.5598
31 G A 0.1486
32 F A 1.5080
33 T A 0.7473
34 H A 0.2248
35 P A -0.3846
36 V A -0.9733
37 R A -1.5175
38 Y A -0.8963
39 Y A 0.0000
40 R A -0.8332
41 I A 0.0000
42 T A -0.6511
43 Y A -0.3779
44 G A -0.8966
45 E A -1.8977
46 T A -1.5513
47 G A -1.4028
48 G A -1.4773
49 N A -1.5402
50 S A -0.9410
51 P A -0.4274
52 V A 0.2731
53 Q A -1.2238
54 E A -1.7935
55 F A -0.6985
56 T A -0.2571
57 V A 0.0000
58 P A -1.0073
59 G A -1.2377
60 S A -1.1843
61 K A -1.7971
62 S A -1.2786
63 T A -0.8065
64 A A 0.0000
65 T A -0.3450
66 F A 0.0000
67 S A -0.7562
68 G A -1.0072
69 L A 0.0000
70 K A -2.5082
71 P A -2.0215
72 G A -1.3688
73 V A -1.6161
74 D A -3.0313
75 Y A 0.0000
76 T A -0.9531
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3141
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6227
85 Y A 0.0000
86 P A -0.4552
87 R A -1.1219
88 Y A 0.6607
89 G A 0.6007
90 Y A 0.9011
91 G A 0.3517
92 E A -0.5996
93 S A 0.0000
94 G A -0.9131
95 P A -0.5293
96 V A -0.2605
97 S A -0.3566
98 F A -0.5616
99 N A -1.7406
100 Y A -1.5745
101 R A -2.4870
102 T A 0.0000
103 E A -2.0394
104 L A -1.1350
105 D A -2.6783
106 K A -2.7643
107 P A -1.8078
108 S A -1.6308
109 Q A -1.6580
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018