Project name: ref

Status: done

Started: 2026-06-26 06:15:11
Settings
Chain sequence(s) A: RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
B: MRLRKLPDSFFKPP
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:46)
Show buried residues

Minimal score value
-3.3969
Maximal score value
2.4003
Average score
-0.7036
Total score value
-163.2251

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
217 R A -2.1290
218 S A -0.9650
219 V A 0.0000
220 A A -0.7882
221 S A 0.0000
222 S A -0.9027
223 K A -1.5024
224 L A 0.0000
225 W A -0.6251
226 M A 0.0000
227 L A -0.7939
228 E A -1.0564
229 F A -0.3488
230 S A -0.2976
231 A A 0.0512
232 F A 0.0000
233 L A 0.0000
234 E A -1.3698
235 Q A -1.6126
236 Q A -2.0467
237 Q A -2.3680
238 D A -2.1007
239 P A -1.6374
240 D A -2.1620
241 T A -1.2472
242 Y A -0.7556
243 N A -1.5363
244 K A -1.7214
245 H A -1.0752
246 L A -0.0587
247 F A 0.0000
248 V A 0.0000
249 H A -0.6359
250 I A 0.0000
251 G A -1.5029
252 Q A -1.9404
253 S A -1.2946
254 S A -0.9269
255 P A -0.6243
256 S A -0.1516
257 Y A 0.5788
258 S A -0.4210
259 D A -1.3569
260 P A -0.6720
261 Y A 0.5774
262 L A 0.3592
263 E A -0.2084
264 A A -0.3823
265 V A 0.0000
266 D A 0.0000
267 I A 0.0000
268 R A -2.8314
269 Q A -2.3100
270 I A 0.0000
271 Y A -1.8263
272 D A -2.4226
273 K A -1.3274
274 F A 0.0000
275 P A -2.0492
276 E A -2.8746
277 K A -3.3119
278 K A -3.1202
279 G A -2.1678
280 G A 0.0000
281 L A 0.0000
282 K A -3.2733
283 D A -3.1167
284 L A -2.1356
285 F A 0.0000
286 E A -3.3969
287 R A -3.0197
288 G A -1.9825
289 P A -1.3051
290 S A -1.3149
291 N A -0.7911
292 A A 0.0000
293 F A 0.0000
294 F A 0.0000
295 L A 0.0000
296 V A 0.0000
297 K A 0.0000
298 F A 0.0000
299 W A -0.2348
300 A A 0.0000
301 D A 0.0000
302 L A 0.0000
303 N A -1.1477
304 T A -1.3059
305 N A -1.3221
306 I A -0.2105
307 E A -2.1318
308 D A -1.5996
309 E A -1.7117
310 G A -1.8213
311 S A -1.1752
312 S A -0.8910
313 F A -0.1598
314 Y A 0.0000
315 G A 0.0000
316 V A -0.1996
317 S A -0.9891
318 S A 0.0000
319 Q A -1.1517
320 Y A 0.0000
321 E A 0.0000
322 S A 0.0000
323 P A -1.3447
324 E A -2.0687
325 N A -1.8196
326 M A 0.0000
327 I A -0.3524
328 I A 0.0000
329 T A -0.2235
330 C A 0.0000
331 S A 0.2991
332 T A 0.0235
333 K A -0.3472
334 V A 0.0000
335 C A 0.0000
336 S A 0.0000
337 F A 0.7980
338 G A 0.0000
339 K A -1.6529
340 Q A -0.5889
341 V A 0.5439
342 V A -0.0025
343 E A -0.2206
344 K A 0.1159
345 V A 1.1996
346 E A 0.3251
347 T A 0.0471
348 E A -0.3668
349 Y A 0.4965
350 A A -0.8313
351 R A -1.5836
352 Y A -0.6251
353 E A -1.4176
354 N A -1.6553
355 G A -1.1785
356 H A -1.5421
357 Y A -1.1080
358 S A -1.2256
359 Y A 0.0000
360 R A -2.2996
361 I A -1.4595
362 H A -1.7372
363 R A -1.2699
364 S A -0.6444
365 P A -0.5995
366 L A 0.0000
367 C A -0.7143
368 E A -1.5596
369 Y A -0.2392
370 M A -0.2184
371 I A -0.5953
372 N A -1.4088
373 F A -0.8331
374 I A -0.9934
375 H A -1.5961
376 K A -2.3914
377 L A 0.0000
378 K A -1.9495
379 H A -1.9146
380 L A -1.1033
381 P A -1.0371
382 E A -1.4959
383 K A -0.4431
384 Y A 0.8820
385 M A 0.5126
386 M A 0.0000
387 N A 0.0000
388 S A 0.3363
389 V A 0.8246
390 L A 0.0000
391 E A -0.4766
392 N A -0.6534
393 F A 0.0000
394 T A 0.0000
395 I A 0.0000
396 L A 0.0000
397 Q A 0.0000
398 V A 0.0000
399 V A 0.0000
400 T A -1.0632
401 N A 0.0000
402 R A -2.2215
403 D A -2.6466
404 T A -1.9601
405 Q A -2.4239
406 E A -2.1572
407 T A 0.0000
408 L A 0.0000
409 L A 0.0000
410 C A 0.0000
411 I A 0.0000
412 A A 0.0000
413 Y A 0.0000
414 V A 0.0000
415 F A 0.0134
416 E A 0.0000
417 V A 0.0000
418 S A 0.0000
419 A A -0.8448
420 S A -1.5419
421 E A -2.4638
422 H A -2.1330
423 G A -1.5331
424 A A 0.0000
425 Q A -1.5783
426 H A -0.7683
427 H A -0.4415
428 I A -0.1100
429 Y A 0.0000
430 R A -0.3204
431 L A 0.0000
432 V A -1.4642
433 K A -3.0267
434 E A -2.9049
1 M B -0.1574
2 R B -0.0884
3 L B 1.0406
4 R B -0.0640
5 K B 0.0000
6 L B 1.1821
7 P B 1.1069
8 D B 0.0000
9 S B 0.8215
10 F B 2.4003
11 F B 2.1082
12 K B -0.1747
13 P B -0.1427
14 P B -0.0033
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018