Project name: obj1 [mutate: ER1C, VR5C, GN9C, QD13C, GC15C, AQ24C, SE31C, SG35C, KI43C, GH56C, YG60C, KL65C, RF67C, NP74C, YW80C, MV83C, AY88C, YS95C, DW101C, WF110C, LM115C, TC117C, SA120C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GH56C,NP74C,QD13C,SG35C,SE31C,GC15C,YS95C,GN9C,TC117C,ER1C,VR5C,WF110C,AQ24C,KI43C,RF67C,KL65C,YG60C,LM115C,YW80C,MV83C,AY88C,SA120C,DW101C
Energy difference between WT (input) and mutated protein (by FoldX)	35.4824 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:07:23)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:52)

• Minimal score value: -2.6533
• Maximal score value: 1.5311
• Average score: -0.3549
• Total score value: -42.5838

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	R	C	-2.0760	mutated: ER1C
2	V	C	-0.9096
3	Q	C	-1.6687
4	L	C	0.0000
5	R	C	-1.4987	mutated: VR5C
6	E	C	0.0000
7	S	C	-0.9630
8	G	C	-0.9126
9	N	C	-0.2135	mutated: GN9C
10	G	C	0.6993
11	L	C	1.2348
12	V	C	0.1404
13	D	C	-1.2456	mutated: QD13C
14	P	C	-0.5345
15	C	C	-0.0179	mutated: GC15C
16	G	C	-0.4459
17	S	C	-0.7655
18	L	C	-0.8465
19	R	C	-1.9961
20	L	C	0.0000
21	S	C	-0.7389
22	C	C	0.0000
23	A	C	-0.9222
24	Q	C	0.0000	mutated: AQ24C
25	S	C	-0.5059
26	D	C	0.0000
27	F	C	1.3471
28	T	C	-0.2467
29	F	C	0.0000
30	R	C	-2.6533
31	E	C	-2.4959	mutated: SE31C
32	Y	C	-1.3976
33	E	C	-0.8633
34	M	C	0.0000
35	G	C	0.0000	mutated: SG35C
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	0.4146
40	A	C	0.1452
41	P	C	-0.1406
42	G	C	0.3306
43	I	C	1.5311	mutated: KI43C
44	G	C	0.6724
45	L	C	1.1707
46	E	C	0.1499
47	W	C	0.3441
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.9437
53	G	C	-1.7963
54	S	C	-1.5245
55	G	C	-1.1731
56	H	C	-1.2350	mutated: GH56C
57	S	C	-0.5510
58	T	C	-0.0127
59	Y	C	0.8822
60	G	C	0.4267	mutated: YG60C
61	A	C	-0.4093
62	D	C	-1.3736
63	S	C	-0.7777
64	V	C	0.0000
65	L	C	1.1161	mutated: KL65C
66	G	C	0.4757
67	F	C	1.1199	mutated: RF67C
68	F	C	0.4630
69	T	C	0.1591
70	I	C	0.0000
71	S	C	-0.2749
72	R	C	0.0000
73	D	C	-1.2729
74	P	C	-1.8408	mutated: NP74C
75	S	C	-1.4978
76	K	C	-2.0641
77	N	C	-1.3916
78	T	C	-1.1366
79	L	C	0.0000
80	W	C	-0.2890	mutated: YW80C
81	L	C	0.0000
82	Q	C	-0.7914
83	V	C	0.0000	mutated: MV83C
84	N	C	-0.4808
85	S	C	-0.2081
86	L	C	0.0000
87	R	C	-1.0760
88	Y	C	-0.1660	mutated: AY88C
89	E	C	-1.5147
90	D	C	0.0000
91	T	C	0.0076
92	A	C	0.0000
93	I	C	0.8049
94	Y	C	0.0000
95	S	C	0.0000	mutated: YS95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-1.0297
101	W	C	-0.0198	mutated: DW101C
102	G	C	-0.4749
103	F	C	-0.4845
104	N	C	-1.8182
105	K	C	-2.1919
106	G	C	-1.1907
107	F	C	-0.1062
108	D	C	-0.5208
109	Y	C	0.1175
110	F	C	0.8822	mutated: WF110C
111	G	C	-0.4813
112	Q	C	-1.2570
113	G	C	-0.3983
114	T	C	-0.1605
115	M	C	0.8013	mutated: LM115C
116	V	C	0.0000
117	C	C	0.6046	mutated: TC117C
118	V	C	0.0000
119	S	C	-0.3068
120	A	C	-0.3241	mutated: SA120C