Project name: query_structure

Status: done

Started: 2026-03-16 22:48:22
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAQPMYRSVSYYRITYGETGGNSPVQEFTVPGSSYTATISGLKPGVDYTITVYAYSYYKGWYWSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)
Show buried residues

Minimal score value
-2.5506
Maximal score value
1.7402
Average score
-0.3083
Total score value
-28.9777

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6175
2 S A 0.5190
3 S A 0.1903
4 V A 0.0000
5 P A 0.0000
6 T A -1.3771
7 K A -2.5506
8 L A 0.0000
9 E A -1.4271
10 V A 0.3420
11 V A 1.6587
12 A A 0.9488
13 A A 0.2955
14 T A -0.3476
15 P A -1.1314
16 T A -0.9984
17 S A -0.5359
18 L A 0.0000
19 L A 0.8074
20 I A 0.0000
21 S A -0.3583
22 W A 0.0000
23 D A -2.2463
24 A A -1.0144
25 Q A 0.0000
26 P A -0.4127
27 M A 0.4455
28 Y A -0.2893
29 R A -1.6297
30 S A -0.2986
31 V A 0.2801
32 S A 0.2939
33 Y A 0.3855
34 Y A 0.0000
35 R A -0.4168
36 I A 0.0000
37 T A -0.6014
38 Y A 0.0000
39 G A 0.0000
40 E A -1.5991
41 T A -1.2853
42 G A -1.2440
43 G A -1.3950
44 N A -1.5324
45 S A -0.8564
46 P A -0.3459
47 V A 0.3701
48 Q A -0.9454
49 E A -1.6931
50 F A -0.6748
51 T A -0.1919
52 V A 0.1527
53 P A -0.0984
54 G A -0.1824
55 S A -0.0958
56 S A 0.0489
57 Y A 0.3258
58 T A 0.2615
59 A A 0.0000
60 T A 0.3047
61 I A 0.0000
62 S A -0.6619
63 G A -1.0349
64 L A 0.0000
65 K A -2.3730
66 P A -1.6575
67 G A -1.4465
68 V A -1.4153
69 D A -2.1304
70 Y A 0.0000
71 T A -0.8284
72 I A 0.0000
73 T A -0.1920
74 V A 0.0000
75 Y A 0.5476
76 A A 0.0000
77 Y A 1.1751
78 S A 0.0000
79 Y A 1.6267
80 Y A 1.2587
81 K A -0.3727
82 G A 0.3446
83 W A 1.6329
84 Y A 1.7402
85 W A 1.1948
86 S A 0.3712
87 P A 0.1899
88 I A -0.1184
89 S A -0.4975
90 I A -0.6138
91 N A -1.6856
92 Y A -1.4289
93 R A -2.5497
94 T A -1.5253
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018