Project name: Mb5-11_IVLFYL

Status: done

Started: 2026-07-06 06:33:13
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQISWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTFTVYAVTWYPRYGYGESGPYSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)
Show buried residues

Minimal score value
-2.7153
Maximal score value
1.4314
Average score
-0.6928
Total score value
-75.5123

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3428
2 Q A -1.0463
3 A A -1.0787
4 N A -1.9020
5 S A -1.2689
6 G A 0.0000
7 S A -1.2235
8 L A 0.0000
9 E A -1.7659
10 V A -0.5403
11 V A 0.3305
12 E A -1.3156
13 A A -1.1224
14 S A -1.4123
15 P A -1.6442
16 T A -1.0643
17 S A -1.1225
18 L A 0.0000
19 Q A -0.9150
20 I A 0.0000
21 S A -1.0065
22 W A 0.0000
23 D A -2.0101
24 A A -1.4065
25 F A 0.0000
26 H A -1.1981
27 R A -0.3781
28 Y A 0.8009
29 H A 0.0431
30 N A -0.6769
31 G A 0.0671
32 F A 1.4314
33 T A 0.6999
34 H A 0.0000
35 P A -0.4023
36 V A -1.0306
37 R A -1.4115
38 Y A -0.9629
39 Y A 0.0000
40 R A -0.8479
41 V A 0.0000
42 T A -0.7159
43 Y A 0.0000
44 G A 0.0000
45 E A -1.3442
46 T A -1.0780
47 G A -1.1600
48 G A -1.3001
49 N A -1.5103
50 S A -0.8932
51 P A -0.4091
52 V A 0.2705
53 Q A -1.2374
54 E A -1.8311
55 F A -0.7291
56 T A -0.2566
57 V A 0.0000
58 P A -1.1046
59 G A -1.3622
60 S A -1.3895
61 K A -1.9605
62 S A -1.2505
63 T A -0.8788
64 A A -0.4523
65 T A -0.4200
66 L A 0.0000
67 S A -0.7598
68 G A -0.9494
69 L A 0.0000
70 K A -2.1192
71 P A -1.7309
72 G A -0.9907
73 V A -0.8336
74 D A -1.8182
75 Y A 0.0000
76 T A -0.6986
77 F A 0.0000
78 T A -0.4490
79 V A 0.0000
80 Y A -0.2616
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.6684
85 Y A 0.0000
86 P A -0.4174
87 R A -1.0886
88 Y A 0.7359
89 G A 0.7713
90 Y A 1.1928
91 G A 0.3964
92 E A -0.5509
93 S A 0.0000
94 G A -0.5822
95 P A -0.4451
96 Y A -0.2715
97 S A -0.4762
98 L A -0.5137
99 N A -1.5177
100 Y A -1.3579
101 R A -2.2695
102 T A 0.0000
103 E A -1.8484
104 L A -0.9273
105 D A -2.5382
106 K A -2.7153
107 P A -1.7878
108 S A -1.6453
109 Q A -1.6626
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018