Project name: 4ba7dff0b82d35a

Status: done

Started: 2026-06-22 16:07:17
Settings
Chain sequence(s) B: MAELMEAMKILKEYKSKLEAAKTPEEVLELWKELVEKAKEIKELIEKAKK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)
Show buried residues

Minimal score value
-4.1201
Maximal score value
0.9225
Average score
-1.8345
Total score value
-91.7252

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.9225
2 A B 0.3386
3 E B -0.8559
4 L B -0.0201
5 M B 0.6730
6 E B -1.2655
7 A B 0.0000
8 M B -0.6481
9 K B -2.4647
10 I B 0.0000
11 L B -1.6773
12 K B -3.3163
13 E B -3.0497
14 Y B 0.0000
15 K B -3.2528
16 S B -2.7561
17 K B -2.9340
18 L B -1.9127
19 E B -2.5982
20 A B -1.8992
21 A B -2.0862
22 K B -2.4149
23 T B -1.6173
24 P B -1.3080
25 E B -2.1573
26 E B -2.0372
27 V B -0.5688
28 L B -0.0923
29 E B -1.9232
30 L B -1.1188
31 W B 0.0914
32 K B -1.8179
33 E B -2.0932
34 L B -1.1560
35 V B -1.2093
36 E B -3.1271
37 K B -2.5722
38 A B -2.5042
39 K B -3.8685
40 E B -3.8248
41 I B -2.7606
42 K B -3.8275
43 E B -4.1201
44 L B 0.0000
45 I B -2.1449
46 E B -3.3002
47 K B -3.1963
48 A B -2.1138
49 K B -3.1071
50 K B -3.0324
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018