Project name: obj1 [mutate: GC8C, GH10C, LT4C, EV1C]

Status: done

Started: 2025-02-10 14:33:59
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues EV1C,GC8C,GH10C,LT4C
Energy difference between WT (input) and mutated protein (by FoldX) 10.7639 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:39)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)
Show buried residues

Minimal score value
-3.3323
Maximal score value
1.706
Average score
-0.5744
Total score value
-68.9307

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V C 1.5890 mutated: EV1C
2 V C 0.8050
3 Q C -0.4597
4 T C 0.0000 mutated: LT4C
5 V C 0.5675
6 E C 0.4196
7 S C 0.0003
8 C C -0.0238 mutated: GC8C
9 G C 0.1968
10 H C 0.3389 mutated: GH10C
11 L C 1.0366
12 V C -0.2895
13 Q C -1.3614
14 P C -1.5008
15 G C -1.4206
16 G C -1.0305
17 S C -1.2611
18 L C 0.0000
19 R C -1.6605
20 L C 0.0000
21 S C -0.2137
22 C C 0.0000
23 A C -0.1988
24 A C 0.0000
25 S C 0.2717
26 D C 0.0000
27 F C 1.5425
28 T C 0.2500
29 F C 0.0000
30 R C -2.0325
31 S C -0.8863
32 Y C -1.2160
33 E C -1.1451
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.2919
40 A C -0.9822
41 P C -1.2942
42 G C -1.4333
43 K C -2.1318
44 G C -1.0521
45 L C 0.4092
46 E C -0.3838
47 W C 0.3439
48 V C 0.0000
49 S C 0.0000
50 A C 0.0000
51 I C 0.0000
52 S C -0.5836
53 G C -1.2447
54 S C -1.2291
55 G C -1.0828
56 G C -0.7350
57 S C -0.3030
58 T C 0.1982
59 Y C 0.6077
60 Y C -0.3559
61 A C -1.1386
62 D C -2.3443
63 S C -1.7150
64 V C 0.0000
65 K C -2.3847
66 G C -1.6175
67 R C 0.0000
68 F C 0.0000
69 T C -0.6441
70 I C 0.0000
71 S C -0.5718
72 R C -1.3644
73 D C -1.9817
74 N C -2.1905
75 S C -1.7905
76 K C -2.3163
77 N C -1.6491
78 T C 0.0000
79 L C 0.0000
80 Y C -0.5143
81 L C 0.0000
82 Q C -1.1706
83 M C 0.0000
84 N C -1.3338
85 S C -1.2533
86 L C 0.0000
87 R C -2.4781
88 A C -1.8956
89 E C -2.3445
90 D C 0.0000
91 T C -0.5127
92 A C 0.0000
93 I C 1.0142
94 Y C 0.0000
95 Y C 0.6460
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.1730
101 D C -3.3323
102 G C -2.0863
103 F C -1.2307
104 N C -2.4282
105 K C -3.1836
106 G C -1.8953
107 F C -0.9549
108 D C -0.6896
109 Y C 0.3939
110 W C 0.5964
111 G C -0.0540
112 Q C -0.8795
113 G C 0.1222
114 T C 0.6608
115 L C 1.7060
116 V C 0.0000
117 T C 0.1280
118 V C 0.0000
119 S C -0.7868
120 S C -1.0658
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018