Project name: obj1 [mutate: GC8C, GH10C, LT4C, EV1C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	EV1C,GC8C,GH10C,LT4C
Energy difference between WT (input) and mutated protein (by FoldX)	10.7639 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:39)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)

• Minimal score value: -3.3323
• Maximal score value: 1.706
• Average score: -0.5744
• Total score value: -68.9307

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	V	C	1.5890	mutated: EV1C
2	V	C	0.8050
3	Q	C	-0.4597
4	T	C	0.0000	mutated: LT4C
5	V	C	0.5675
6	E	C	0.4196
7	S	C	0.0003
8	C	C	-0.0238	mutated: GC8C
9	G	C	0.1968
10	H	C	0.3389	mutated: GH10C
11	L	C	1.0366
12	V	C	-0.2895
13	Q	C	-1.3614
14	P	C	-1.5008
15	G	C	-1.4206
16	G	C	-1.0305
17	S	C	-1.2611
18	L	C	0.0000
19	R	C	-1.6605
20	L	C	0.0000
21	S	C	-0.2137
22	C	C	0.0000
23	A	C	-0.1988
24	A	C	0.0000
25	S	C	0.2717
26	D	C	0.0000
27	F	C	1.5425
28	T	C	0.2500
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1451
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2919
40	A	C	-0.9822
41	P	C	-1.2942
42	G	C	-1.4333
43	K	C	-2.1318
44	G	C	-1.0521
45	L	C	0.4092
46	E	C	-0.3838
47	W	C	0.3439
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5836
53	G	C	-1.2447
54	S	C	-1.2291
55	G	C	-1.0828
56	G	C	-0.7350
57	S	C	-0.3030
58	T	C	0.1982
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6441
70	I	C	0.0000
71	S	C	-0.5718
72	R	C	-1.3644
73	D	C	-1.9817
74	N	C	-2.1905
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.5143
81	L	C	0.0000
82	Q	C	-1.1706
83	M	C	0.0000
84	N	C	-1.3338
85	S	C	-1.2533
86	L	C	0.0000
87	R	C	-2.4781
88	A	C	-1.8956
89	E	C	-2.3445
90	D	C	0.0000
91	T	C	-0.5127
92	A	C	0.0000
93	I	C	1.0142
94	Y	C	0.0000
95	Y	C	0.6460
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1730
101	D	C	-3.3323
102	G	C	-2.0863
103	F	C	-1.2307
104	N	C	-2.4282
105	K	C	-3.1836
106	G	C	-1.8953
107	F	C	-0.9549
108	D	C	-0.6896
109	Y	C	0.3939
110	W	C	0.5964
111	G	C	-0.0540
112	Q	C	-0.8795
113	G	C	0.1222
114	T	C	0.6608
115	L	C	1.7060
116	V	C	0.0000
117	T	C	0.1280
118	V	C	0.0000
119	S	C	-0.7868
120	S	C	-1.0658