Project name: query_structure

Status: done

Started: 2026-03-16 22:47:50
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVSYYVITYGETGSPYWHYQTFTVPGSKSTATISGLKPGVDYTITVYAYSPYYPAPYRSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-2.6755
Maximal score value
1.7871
Average score
-0.3247
Total score value
-30.8425

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7871
2 S A 0.7974
3 S A 0.4763
4 V A 0.1997
5 P A 0.0000
6 T A -1.6413
7 K A -2.6755
8 L A 0.0000
9 E A -1.9064
10 V A 0.1465
11 V A 1.5607
12 A A 0.9124
13 A A 0.3263
14 T A -0.3302
15 P A -1.1016
16 T A -0.9890
17 S A -0.5175
18 L A 0.0000
19 L A 0.7814
20 I A 0.0000
21 S A -0.9609
22 W A 0.0000
23 D A -2.6663
24 A A -1.2467
25 P A 0.0278
26 A A 0.4499
27 V A 0.6873
28 T A 0.2115
29 V A 0.0927
30 S A 0.2126
31 Y A -0.2142
32 Y A 0.0000
33 V A 0.1420
34 I A 0.0000
35 T A 0.0000
36 Y A -0.4449
37 G A 0.0000
38 E A -1.7592
39 T A -1.0870
40 G A -0.6867
41 S A -0.3427
42 P A 0.2951
43 Y A 1.1880
44 W A 1.1136
45 H A -0.4030
46 Y A -0.2967
47 Q A -0.9483
48 T A -0.2896
49 F A 0.2597
50 T A 0.2940
51 V A 0.0000
52 P A -0.6512
53 G A -0.6098
54 S A -1.0694
55 K A -1.9992
56 S A -1.3791
57 T A -0.7508
58 A A 0.0000
59 T A 0.2499
60 I A 0.0000
61 S A -0.6562
62 G A -1.0262
63 L A 0.0000
64 K A -2.3875
65 P A -1.6354
66 G A -1.4382
67 V A -1.4574
68 D A -2.1202
69 Y A 0.0000
70 T A -1.0000
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.0000
75 A A 0.0000
76 Y A 0.0965
77 S A 0.0000
78 P A 0.5448
79 Y A 1.4042
80 Y A 1.6694
81 P A 0.8405
82 A A 0.6278
83 P A 0.5800
84 Y A 0.7118
85 R A -1.0574
86 S A -0.5402
87 S A -0.4030
88 P A -0.3154
89 I A 0.0279
90 S A -0.5434
91 I A -0.7117
92 N A -1.7613
93 Y A -1.4973
94 R A -2.5451
95 T A -1.4942
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018