Project name: query_structure

Status: done

Started: 2026-03-16 21:41:49
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIYYIESYPAGEAIVLTVPGSCRSYDLTGLKPGTEYWVGIDGVKGGRWSTPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)
Show buried residues

Minimal score value
-3.1998
Maximal score value
2.2298
Average score
-0.5656
Total score value
-50.9023

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8193
2 L A 0.2524
3 P A -0.0598
4 A A -0.3675
5 P A 0.0000
6 K A -2.1377
7 N A -1.5595
8 L A -0.2332
9 V A 1.0935
10 V A 0.6050
11 S A -0.6467
12 R A -2.0343
13 V A -1.0820
14 T A -1.8274
15 E A -3.1062
16 D A -2.8357
17 S A -2.1459
18 A A 0.0000
19 R A -1.2571
20 L A 0.0000
21 S A -0.2976
22 W A 0.0000
23 T A -1.2420
24 A A 0.0000
25 P A -1.3919
26 D A -2.1468
27 A A -1.4221
28 A A -1.1764
29 F A 0.0000
30 D A -2.5977
31 S A -1.0272
32 F A 0.0000
33 F A 0.9977
34 I A 0.0000
35 Y A 1.2127
36 Y A 0.8462
37 I A 0.0000
38 E A -1.6023
39 S A -0.5754
40 Y A 0.5861
41 P A 0.0768
42 A A -0.3120
43 G A -1.0940
44 E A -1.5740
45 A A 0.0041
46 I A 1.1013
47 V A 2.2298
48 L A 1.5291
49 T A 0.6174
50 V A 0.0000
51 P A -0.7165
52 G A 0.0000
53 S A -1.0548
54 C A -0.5563
55 R A -0.6226
56 S A -0.3391
57 Y A -0.5394
58 D A -1.7339
59 L A 0.0000
60 T A -1.3915
61 G A -1.5246
62 L A 0.0000
63 K A -3.1998
64 P A -2.6109
65 G A -1.9704
66 T A -2.2385
67 E A -1.6576
68 Y A 0.0000
69 W A 0.7084
70 V A 0.0000
71 G A 0.0000
72 I A 0.0000
73 D A 0.0000
74 G A 0.0000
75 V A -0.9901
76 K A -1.8946
77 G A -1.7846
78 G A -1.7562
79 R A -1.8099
80 W A -0.0498
81 S A 0.0000
82 T A 0.1628
83 P A -0.0880
84 L A -0.3450
85 S A 0.5576
86 A A 1.3052
87 I A 2.0567
88 F A 0.0000
89 T A -1.0163
90 T A -2.0216
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018