Project name: 4db60983423b451

Status: done

Started: 2026-03-21 17:19:27
Settings
Chain sequence(s) A: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAPAPAPPAPAPPAPAPPQAGSKSQRAKYGTAGYGVEEAAAEKDTRISKKMETMGIYFAEAAAEYLDYVHAEKSREAAAEAGRQYHLAMAEAAAERWIGTVSDEDLEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:41)
Show buried residues

Minimal score value
-4.2927
Maximal score value
2.2511
Average score
-1.1645
Total score value
-256.1951

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3221
2 S A -1.2572
3 D A -2.2521
4 K A -2.3926
5 I A 0.0000
6 I A -0.4786
7 H A -1.0523
8 L A 0.0000
9 T A -1.5451
10 D A -1.9763
11 D A -2.5232
12 S A -1.7668
13 F A 0.0000
14 D A -2.2944
15 T A -1.7593
16 D A -1.7739
17 V A 0.0000
18 L A -1.9348
19 K A -2.9527
20 A A -2.3667
21 D A -2.7762
22 G A -2.1484
23 A A -1.5000
24 I A 0.0000
25 L A 0.0000
26 V A 0.0000
27 D A 0.0000
28 F A 0.0000
29 W A -0.4685
30 A A 0.0000
31 E A -1.8058
32 W A -0.2376
33 C A 0.0000
34 G A -0.8728
35 P A -0.4603
36 C A 0.0000
37 K A -1.6578
38 M A -0.1735
39 I A 0.0000
40 A A -0.5276
41 P A -0.6986
42 I A -0.9691
43 L A 0.0000
44 D A -2.0357
45 E A -2.8738
46 I A 0.0000
47 A A 0.0000
48 D A -4.0413
49 E A -3.7882
50 Y A 0.0000
51 Q A -3.1936
52 G A -2.3248
53 K A -2.5343
54 L A 0.0000
55 T A -1.2470
56 V A 0.0000
57 A A 0.0000
58 K A 0.0000
59 L A 0.0000
60 N A 0.0000
61 I A -1.2233
62 D A -2.3959
63 Q A -2.1265
64 N A 0.0000
65 P A -1.4063
66 G A -1.3769
67 T A 0.0000
68 A A 0.0000
69 P A -1.4955
70 K A -1.8500
71 Y A -0.8984
72 G A -1.4219
73 I A 0.0000
74 R A -1.9055
75 G A -0.8884
76 I A 0.0655
77 P A 0.0000
78 T A 0.0000
79 L A 0.0000
80 L A 0.0000
81 L A 0.0000
82 F A 0.0000
83 K A -1.9558
84 N A -2.8028
85 G A -2.3644
86 E A -2.0567
87 V A -0.2491
88 A A -0.4280
89 A A -0.1986
90 T A 0.1943
91 K A 0.2191
92 V A 1.1733
93 G A 0.5465
94 A A -0.0022
95 L A -0.1879
96 S A -0.6979
97 K A -1.6275
98 G A -1.7575
99 Q A -2.2861
100 L A 0.0000
101 K A -2.6793
102 E A -3.1248
103 F A -1.9102
104 L A 0.0000
105 D A -2.5848
106 A A -1.4358
107 N A -1.1279
108 L A -1.1894
109 A A -0.6084
110 P A -0.4573
111 A A -0.2223
112 P A -0.3652
113 A A -0.2714
114 P A -0.4318
115 P A -0.4301
116 A A -0.2699
117 P A -0.4090
118 A A -0.2697
119 P A -0.4300
120 P A -0.4316
121 A A -0.2671
122 P A -0.4026
123 A A -0.4514
124 P A -0.7058
125 P A -1.0314
126 Q A -1.5081
127 A A -1.1837
128 G A -1.5420
129 S A -1.6227
130 K A -2.6566
131 S A -2.3206
132 Q A -3.0309
133 R A -2.9712
134 A A -1.9809
135 K A -1.8785
136 Y A -0.0513
137 G A -0.2800
138 T A -0.0246
139 A A 0.5845
140 G A 0.0022
141 Y A 0.4084
142 G A -0.2124
143 V A 0.2393
144 E A -2.0544
145 E A -2.8798
146 A A -2.0817
147 A A -2.5757
148 A A -3.0212
149 E A -4.0367
150 K A -4.2927
151 D A -3.8360
152 T A -3.0302
153 R A -3.7733
154 I A -1.6761
155 S A -2.2647
156 K A -3.2917
157 K A -2.1658
158 M A -0.4920
159 E A -1.6113
160 T A -0.1353
161 M A 0.7320
162 G A 0.6389
163 I A 1.7328
164 Y A 2.2511
165 F A 2.1429
166 A A 0.9312
167 E A -0.4648
168 A A 0.1386
169 A A 0.4851
170 A A -0.3903
171 E A -1.3339
172 Y A 0.7007
173 L A 0.5067
174 D A -1.2428
175 Y A 0.2816
176 V A -0.3636
177 H A -1.9821
178 A A -1.7197
179 E A -2.7125
180 K A -3.6165
181 S A -2.9654
182 R A -3.9534
183 E A -4.1260
184 A A -2.8541
185 A A -2.5090
186 A A -2.7020
187 E A -3.4567
188 A A -1.9537
189 G A -1.7273
190 R A -2.5131
191 Q A -1.5587
192 Y A -0.0183
193 H A -0.6940
194 L A 0.4770
195 A A 0.2621
196 M A 0.6920
197 A A -0.1677
198 E A -1.6130
199 A A -1.2426
200 A A -0.6568
201 A A -0.9862
202 E A -2.1841
203 R A -1.7932
204 W A 0.5205
205 I A 1.1506
206 G A -0.6548
207 T A -0.8505
208 V A -0.2144
209 S A -1.1769
210 D A -2.9547
211 E A -3.7932
212 D A -3.3608
213 L A -1.9722
214 E A -3.7071
215 H A -3.6005
216 H A -3.1679
217 H A -2.8720
218 H A -2.9583
219 H A -2.5382
220 H A -2.0178
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018