Project name: AMK70585_AMK70586

Status: done

Started: 2026-04-19 21:40:52
Settings
Chain sequence(s) H: EVQLLESGGGLVQPGGSLRLSCAASGFTFNRYTMNWVRQAPGKGLEWLSYITSSGSTKSYADSVKGRFTISRDNAKKSLYLQMNGLRDEDTAVYYCASGLRDLGVLLVPADYDGMDVWGQGTTVTVSS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-3.8671
Maximal score value
3.1319
Average score
-0.6051
Total score value
-77.4526

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E H -1.5693
2 V H -0.1574
3 Q H -0.1862
4 L H 0.0000
5 L H 0.5859
6 E H -0.0982
7 S H -0.5485
8 G H -0.8215
9 G H -0.3341
11 G H 0.3123
12 L H 1.1755
13 V H -0.2933
14 Q H -1.7149
15 P H -2.2721
16 G H -1.8612
17 G H -1.1379
18 S H -1.1829
19 L H -0.4738
20 R H -1.2592
21 L H 0.0000
22 S H -0.3495
23 C H 0.0000
24 A H -0.2381
25 A H 0.0000
26 S H -0.3765
27 G H -0.7400
28 F H -0.7193
29 T H -1.1285
30 F H 0.0000
35 N H -2.6918
36 R H -2.8275
37 Y H 0.0000
38 T H -0.6721
39 M H 0.0000
40 N H 0.0000
41 W H 0.0000
42 V H 0.0000
43 R H 0.0000
44 Q H -0.4749
45 A H -1.1140
46 P H -1.1005
47 G H -1.3956
48 K H -2.0440
49 G H -0.8486
50 L H 0.6757
51 E H -0.0258
52 W H 0.5657
53 L H 0.0000
54 S H 0.0000
55 Y H 0.1145
56 I H 0.0000
57 T H -0.7989
58 S H -1.3976
59 S H -1.0509
62 G H -0.7890
63 S H -0.5948
64 T H -0.6560
65 K H -0.9514
66 S H -0.8014
67 Y H -1.0475
68 A H -1.2922
69 D H -2.5333
70 S H -1.8180
71 V H 0.0000
72 K H -2.7035
74 G H -1.8500
75 R H -1.7180
76 F H 0.0000
77 T H -0.8717
78 I H 0.0000
79 S H -0.3986
80 R H -1.0136
81 D H -1.5236
82 N H -2.0589
83 A H -1.4763
84 K H -2.3362
85 K H -1.9267
86 S H -1.1619
87 L H 0.0000
88 Y H -0.3352
89 L H 0.0000
90 Q H -0.8009
91 M H 0.0000
92 N H -1.4923
93 G H -1.5876
94 L H 0.0000
95 R H -3.8671
96 D H -3.8400
97 E H -3.3556
98 D H 0.0000
99 T H -1.3583
100 A H 0.0000
101 V H 0.1113
102 Y H 0.0000
103 Y H 0.2979
104 C H 0.0000
105 A H 0.0000
106 S H 0.0000
107 G H 0.0000
108 L H -1.1148
109 R H -2.2399
110 D H -1.6141
111 L H 0.3068
111A G H 1.3208
111B V H 2.5669
111C L H 3.1319
111D L H 2.9496
112D V H 2.3236
112C P H 0.5337
112B A H -0.2614
112A D H -0.4453
112 Y H -0.7044
113 D H -2.1385
114 G H -0.9811
115 M H -0.3011
116 D H -0.7536
117 V H 0.3611
118 W H 0.3672
119 G H 0.0027
120 Q H -0.9503
121 G H -0.4297
122 T H -0.3434
123 T H -0.1233
124 V H 0.0000
125 T H -0.4815
126 V H 0.0000
127 S H -1.4067
128 S H -0.8024
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018