Project name: 4f88575e3bc4072

Chain sequence(s)	A: SDRLNAGKSLGAGGSLAEGPYLFIMQNDCNLVLYDNNRAVWASGTNGKASNCILKMQRDGNLVIYSGSRAMWASNTNRQDGNYYLILQRDRNVVIYDNSNNAIWASGTNV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:14)

• Minimal score value: -3.8341
• Maximal score value: 0.684
• Average score: -1.1348
• Total score value: -124.8294

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.9354
2	D	A	-1.6024
3	R	A	-1.9115
4	L	A	0.0000
5	N	A	-2.6043
6	A	A	0.0000
7	G	A	-2.5061
8	K	A	-2.6017
9	S	A	-1.2257
10	L	A	-0.3825
11	G	A	-0.7120
12	A	A	-1.0579
13	G	A	-1.0108
14	G	A	-0.4017
15	S	A	-0.2563
16	L	A	0.0000
17	A	A	-0.7750
18	E	A	-1.6413
19	G	A	-1.3382
20	P	A	-1.1096
21	Y	A	-1.2595
22	L	A	-0.3151
23	F	A	0.0000
24	I	A	0.0858
25	M	A	0.0000
26	Q	A	-1.3953
27	N	A	-2.2525
28	D	A	-2.3531
29	C	A	0.0000
30	N	A	-1.4869
31	L	A	0.0000
32	V	A	0.0000
33	L	A	0.0000
34	Y	A	-0.8489
35	D	A	-1.7029
36	N	A	-2.4247
37	N	A	-2.6699
38	R	A	-2.5994
39	A	A	-0.9476
40	V	A	-0.1200
41	W	A	0.1158
42	A	A	-0.0340
43	S	A	-0.3498
44	G	A	-1.0696
45	T	A	0.0000
46	N	A	-2.4218
47	G	A	-2.2445
48	K	A	-2.4063
49	A	A	-1.9580
50	S	A	-1.7737
51	N	A	-1.7829
52	C	A	0.0000
53	I	A	-0.1058
54	L	A	0.0000
55	K	A	-1.2239
56	M	A	0.0000
57	Q	A	-2.5666
58	R	A	-3.8341
59	D	A	-3.3827
60	G	A	0.0000
61	N	A	-1.9162
62	L	A	0.0000
63	V	A	0.0000
64	I	A	0.0000
65	Y	A	-0.4766
66	S	A	0.0000
67	G	A	-1.1927
68	S	A	-1.2144
69	R	A	-1.8766
70	A	A	-0.6375
71	M	A	-0.3266
72	W	A	-0.2379
73	A	A	-0.4572
74	S	A	-0.7742
75	N	A	-1.7948
76	T	A	-1.6585
77	N	A	-2.9866
78	R	A	-3.1954
79	Q	A	-3.5417
80	D	A	-3.8234
81	G	A	-2.9915
82	N	A	-3.1100
83	Y	A	0.0000
84	Y	A	-1.7349
85	L	A	0.0000
86	I	A	0.0000
87	L	A	0.0000
88	Q	A	-1.9414
89	R	A	-2.4704
90	D	A	-1.4790
91	R	A	-1.2938
92	N	A	-1.1359
93	V	A	0.0000
94	V	A	0.0000
95	I	A	0.0000
96	Y	A	-1.2170
97	D	A	-1.9972
98	N	A	-2.4876
99	S	A	-2.0363
100	N	A	-2.4542
101	N	A	-2.0848
102	A	A	-0.8006
103	I	A	-0.3842
104	W	A	-0.0665
105	A	A	-0.1536
106	S	A	-0.3861
107	G	A	-0.6580
108	T	A	0.0000
109	N	A	-1.1198
110	V	A	0.6840