Project name: 50be21b1e61f408

Status: done

Started: 2025-03-07 08:41:25
Settings
Chain sequence(s) A: ITILGTGGTIASRIDYETGAVYPAFTAEELAKAVPEIFEIANVKPKLLFNIFSEDMKPSHWVKIAHEVAKELNSGAYGVVVAHGTDTMGYTSAALSFMLRDLNKPVILVGAQRSSDRPSSDAAMNLICSVRMATSEVAEVMVVMHGETGDTYCLAHRGTKVRKMHTSRRDAFRSINDIPIAKIWSDGRIEFLRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:29)
Show buried residues

Minimal score value
-3.2604
Maximal score value
0.8772
Average score
-0.8266
Total score value
-160.352

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.2008
2 T A 0.0000
3 I A 0.0000
4 L A 0.0000
5 G A 0.0000
6 T A 0.0000
7 G A 0.4417
8 G A 0.0000
9 T A -0.3713
10 I A 0.0000
11 A A 0.0000
12 S A -1.3852
13 R A -2.1412
14 I A -1.2409
15 D A -1.6279
16 Y A -0.5843
17 E A -1.7469
18 T A -1.0114
19 G A -0.6019
20 A A -0.2411
21 V A 0.0356
22 Y A 0.2746
23 P A -0.1456
24 A A -0.2970
25 F A -0.2686
26 T A -1.3091
27 A A -1.9473
28 E A -2.5126
29 E A -1.9319
30 L A 0.0000
31 A A -1.7284
32 K A -2.4948
33 A A -1.6597
34 V A 0.0000
35 P A -1.5857
36 E A -2.2489
37 I A 0.0000
38 F A -0.0472
39 E A -1.6097
40 I A -0.9306
41 A A -0.6396
42 N A -1.0572
43 V A -1.0041
44 K A -2.1030
45 P A 0.0000
46 K A -1.3695
47 L A 0.2306
48 L A 0.2164
49 F A 0.6001
50 N A -0.0246
51 I A -0.0533
52 F A 0.6170
53 S A 0.0000
54 E A -2.2949
55 D A -2.3628
56 M A -1.5326
57 K A -2.1131
58 P A -0.8888
59 S A -0.9238
60 H A -1.2205
61 W A 0.0000
62 V A -0.3709
63 K A -1.4435
64 I A 0.0000
65 A A 0.0000
66 H A -1.8199
67 E A -1.6962
68 V A 0.0000
69 A A -1.6964
70 K A -2.8222
71 E A -2.0176
72 L A 0.0000
73 N A -2.2909
74 S A -1.5401
75 G A -1.1029
76 A A 0.0000
77 Y A 0.2044
78 G A 0.0000
79 V A 0.0000
80 V A 0.0000
81 V A 0.0000
82 A A 0.0000
83 H A 0.0000
84 G A -0.4094
85 T A -1.0237
86 D A -1.4682
87 T A -1.0006
88 M A 0.0000
89 G A -0.8834
90 Y A 0.4728
91 T A 0.0000
92 S A 0.0000
93 A A 0.4325
94 A A 0.8772
95 L A 0.0000
96 S A 0.0000
97 F A 0.1968
98 M A 0.0664
99 L A 0.0000
100 R A -2.5367
101 D A -2.4805
102 L A -1.6728
103 N A -2.2242
104 K A -1.4680
105 P A 0.0000
106 V A 0.0000
107 I A 0.0000
108 L A 0.0000
109 V A 0.0000
110 G A 0.0000
111 A A -0.9671
112 Q A -2.1719
113 R A -2.8876
114 S A -1.8285
115 S A -1.8542
116 D A -1.9322
117 R A -2.8156
118 P A -1.6026
119 S A -1.5853
120 S A -1.7841
121 D A 0.0000
122 A A 0.0000
123 A A -0.3721
124 M A -0.3547
125 N A 0.0000
126 L A 0.0000
127 I A 0.0000
128 C A 0.0000
129 S A 0.0000
130 V A 0.0000
131 R A -0.8421
132 M A 0.0000
133 A A 0.0000
134 T A -0.4090
135 S A 0.0000
136 E A -1.8837
137 V A -0.6951
138 A A -1.1790
139 E A -1.6154
140 V A 0.0000
141 M A 0.0000
142 V A 0.0000
143 V A 0.0000
144 M A 0.0000
145 H A 0.0000
146 G A 0.0000
147 E A -2.6446
148 T A -2.1579
149 G A -1.7522
150 D A -2.1878
151 T A -1.2606
152 Y A -0.5230
153 C A 0.0000
154 L A -0.1972
155 A A 0.0000
156 H A 0.0000
157 R A -1.2503
158 G A 0.0000
159 T A -0.7224
160 K A -1.8688
161 V A 0.0000
162 R A -2.9345
163 K A -2.9186
164 M A -1.4376
165 H A -2.0101
166 T A -1.2559
167 S A -2.0695
168 R A -3.2604
169 R A -3.2017
170 D A -2.7291
171 A A 0.0000
172 F A 0.0000
173 R A -2.5561
174 S A 0.0000
175 I A -1.6327
176 N A -1.5590
177 D A -1.3009
178 I A -0.2798
179 P A -0.2608
180 I A -0.1889
181 A A 0.0000
182 K A -0.3881
183 I A 0.0000
184 W A -0.9266
185 S A 0.0000
186 D A -2.1469
187 G A -1.6986
188 R A -1.9839
189 I A -0.8925
190 E A -1.2325
191 F A 0.2254
192 L A 0.2708
193 R A -1.7727
194 D A -2.1060
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018