Project name: ec2f3c7f344d6e40df1681668b161bba

Status: done

Started: 2026-03-07 00:25:17
Settings
Chain sequence(s) B: MVDVSAVDDSKDKELREKVRFYGRIVENEPELSEEALKATAERAKELAKEAGAEDVVIEVGSGC
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:39)
Show buried residues

Minimal score value
-4.7022
Maximal score value
0.3915
Average score
-1.957
Total score value
-125.2511

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B -0.8249
2 V B 0.0000
3 D B -0.4708
4 V B -0.3985
5 S B -0.5044
6 A B -1.3341
7 V B 0.0000
8 D B -3.1180
9 D B -3.3523
10 S B -2.5875
11 K B -3.7798
12 D B -4.5690
13 K B -4.7022
14 E B -4.0814
15 L B -3.4186
16 R B -3.6435
17 E B -2.9864
18 K B -2.0149
19 V B 0.0000
20 R B -0.8767
21 F B 0.3834
22 Y B -0.8296
23 G B 0.0000
24 R B -2.1847
25 I B -1.2364
26 V B 0.0000
27 E B -2.9643
28 N B -3.1816
29 E B -2.8570
30 P B -2.2569
31 E B -2.3420
32 L B -1.7713
33 S B -2.2161
34 E B -3.3716
35 E B -3.1496
36 A B -2.2666
37 L B 0.0000
38 K B -3.4359
39 A B -2.5814
40 T B -2.2703
41 A B 0.0000
42 E B -3.6923
43 R B -3.9467
44 A B 0.0000
45 K B -3.3215
46 E B -4.1181
47 L B -3.3894
48 A B 0.0000
49 K B -4.4009
50 E B -3.7932
51 A B 0.0000
52 G B -3.1855
53 A B 0.0000
54 E B -3.4627
55 D B -2.7216
56 V B -1.4176
57 V B 0.3915
58 I B -0.6158
59 E B -1.6134
60 V B -1.5329
61 G B -1.3672
62 S B -0.7413
63 G B -1.3159
64 C B 0.1883
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018