Project name: AF-Q9HB66-default-c70

Chain sequence(s)	A: SLRNLWRDYKVLVVMVPLVGLIHLGWYRIS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:06)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:06)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:06)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:24)
[CRITICAL]   pyMol:    Pymol encountered an error: /bin/sh: pymol: command not found Movie         
                       creation failed.                                                            (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:24)

• Minimal score value: -2.5659
• Maximal score value: 3.6214
• Average score: 1.2911
• Total score value: 38.7338

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	S	A	-0.4416
3	L	A	0.2392
4	R	A	-2.0443
5	N	A	-2.1727
6	L	A	-0.3499
7	W	A	-0.6119
8	R	A	-2.5659
9	D	A	-1.6126
10	Y	A	0.4016
11	K	A	-0.4713
12	V	A	2.2447
13	L	A	2.9712
14	V	A	2.3121
15	V	A	2.9385
16	M	A	3.4168
17	V	A	3.6214
18	P	A	2.6994
19	L	A	3.4614
20	V	A	3.0047
21	G	A	2.2703
22	L	A	3.3885
23	I	A	2.8941
24	H	A	1.9739
25	L	A	2.1914
26	G	A	1.9690
27	W	A	2.5000
28	Y	A	2.0309
29	R	A	0.3002
30	I	A	1.9020
32	S	A	0.2727