Project name: 5103f424aa5a2

Status: done

Started: 2026-03-21 16:57:29
Settings
Chain sequence(s) A: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAEAAAKEAAAKEAAAKPQAGSKSQRAKYGTAGYGVEEAAAEKDTRISKKMETMGIYFAEAAAEYLDYVHAEKSREAAAEAGRQYHLAMAEAAAERWIGTVSDEDLEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:06)
Show buried residues

Minimal score value
-4.1863
Maximal score value
2.1223
Average score
-1.334
Total score value
-293.4849

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2101
2 S A -1.5135
3 D A -2.5636
4 K A -3.0636
5 I A 0.0000
6 I A -0.5156
7 H A -1.0793
8 L A 0.0000
9 T A -1.6870
10 D A -2.2383
11 D A -2.6474
12 S A -1.8550
13 F A 0.0000
14 D A -2.3924
15 T A -1.8082
16 D A -1.8384
17 V A 0.0000
18 L A -1.9968
19 K A -2.9884
20 A A -2.3773
21 D A -2.7413
22 G A -2.1293
23 A A 0.0000
24 I A 0.0000
25 L A 0.0000
26 V A 0.0000
27 D A 0.0000
28 F A 0.0000
29 W A -0.5613
30 A A 0.0000
31 E A -1.8381
32 W A -0.2432
33 C A 0.0000
34 G A -0.8680
35 P A -0.4789
36 C A 0.0000
37 K A -1.6532
38 M A -0.1945
39 I A 0.0000
40 A A -0.4906
41 P A -0.6620
42 I A -1.0308
43 L A 0.0000
44 D A -2.0711
45 E A -2.9653
46 I A 0.0000
47 A A 0.0000
48 D A -4.1863
49 E A -3.7995
50 Y A 0.0000
51 Q A -3.3088
52 G A -2.3353
53 K A -2.5816
54 L A 0.0000
55 T A -1.3728
56 V A 0.0000
57 A A 0.0000
58 K A 0.0000
59 L A 0.0000
60 N A -1.4354
61 I A -1.3532
62 D A -2.4497
63 Q A -2.2113
64 N A 0.0000
65 P A -1.4756
66 G A -1.4595
67 T A 0.0000
68 A A 0.0000
69 P A -1.4988
70 K A -1.8571
71 Y A -0.9222
72 G A -1.4407
73 I A 0.0000
74 R A -1.9182
75 G A -0.9218
76 I A 0.0331
77 P A 0.0000
78 T A 0.0000
79 L A 0.0000
80 L A 0.0000
81 L A 0.0000
82 F A 0.0000
83 K A -1.7989
84 N A -2.6828
85 G A -2.3415
86 E A -2.0286
87 V A -0.2562
88 A A -0.3897
89 A A -0.1668
90 T A 0.2576
91 K A 0.2521
92 V A 1.1744
93 G A 0.5223
94 A A -0.0845
95 L A 0.0000
96 S A -1.0734
97 K A -1.7904
98 G A -1.8922
99 Q A -2.4804
100 L A 0.0000
101 K A -2.6199
102 E A -3.0445
103 F A -1.8043
104 L A 0.0000
105 D A -2.3820
106 A A -1.5986
107 N A -1.4425
108 L A 0.0000
109 A A -1.4214
110 E A -2.6861
111 A A -2.0076
112 A A -1.5817
113 A A -2.0137
114 K A -3.3750
115 E A -3.5143
116 A A -2.5315
117 A A -2.1983
118 A A -2.3664
119 K A -3.4311
120 E A -3.3901
121 A A -2.0269
122 A A -1.7784
123 A A -2.0741
124 K A -2.7440
125 P A -1.6785
126 Q A -1.8808
127 A A -1.4028
128 G A -1.4783
129 S A -1.6388
130 K A -2.6428
131 S A -2.3389
132 Q A -2.8245
133 R A -2.8619
134 A A -1.8474
135 K A -1.8282
136 Y A -0.2436
137 G A -0.2231
138 T A 0.0257
139 A A 0.6389
140 G A 0.4700
141 Y A 0.5793
142 G A -0.1140
143 V A 0.4756
144 E A -1.8337
145 E A -2.8242
146 A A -2.0211
147 A A -2.5189
148 A A -2.9090
149 E A -4.0838
150 K A -4.0601
151 D A -3.8479
152 T A -3.0614
153 R A -3.8351
154 I A -1.8288
155 S A -2.3911
156 K A -3.4513
157 K A -2.6344
158 M A -0.7128
159 E A -1.7839
160 T A -0.4806
161 M A 0.4711
162 G A 0.5299
163 I A 1.6684
164 Y A 2.1223
165 F A 2.0619
166 A A 0.8575
167 E A -0.4880
168 A A 0.2960
169 A A 0.4970
170 A A -0.3404
171 E A -1.2938
172 Y A 0.7493
173 L A 0.5855
174 D A -1.2324
175 Y A 0.2458
176 V A -0.4493
177 H A -1.8578
178 A A -1.8215
179 E A -2.9648
180 K A -3.7331
181 S A -3.0338
182 R A -4.0369
183 E A -4.0777
184 A A -2.8756
185 A A -2.5147
186 A A -2.6863
187 E A -3.4485
188 A A -1.9477
189 G A -1.7288
190 R A -2.5099
191 Q A -1.5510
192 Y A 0.1703
193 H A -0.6842
194 L A 0.4781
195 A A 0.2521
196 M A 0.5036
197 A A -0.1796
198 E A -1.7570
199 A A -1.2503
200 A A -0.7289
201 A A -1.0462
202 E A -2.1526
203 R A -1.8180
204 W A 0.4837
205 I A 1.0412
206 G A -0.6271
207 T A -0.7660
208 V A 0.0237
209 S A -1.1079
210 D A -2.9017
211 E A -3.7291
212 D A -3.3194
213 L A -2.0132
214 E A -3.7977
215 H A -3.6731
216 H A -3.2055
217 H A -2.9140
218 H A -3.0009
219 H A -2.5549
220 H A -2.0224
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018