Project name: query_structure

Status: done

Started: 2026-03-16 22:57:49
Settings
Chain sequence(s) A: ATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQSFDMTMYYLTLEAKDGGKKKLYEAKVWVKPIDSNFTGTNFKELQEFKPVGDA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:32)
Show buried residues

Minimal score value
-4.1927
Maximal score value
1.0394
Average score
-1.1778
Total score value
-121.3136

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A 0.3296
2 T A 0.2115
3 G A -0.1611
4 V A 0.0361
5 R A -1.5891
6 A A -1.2968
7 V A 0.0000
8 P A -1.3325
9 G A -1.3341
10 N A -1.7355
11 E A -2.1345
12 N A -2.0881
13 S A -1.1825
14 L A -0.3270
15 E A -2.0671
16 I A 0.0000
17 E A -2.5758
18 E A -2.2542
19 L A 0.0000
20 A A 0.0000
21 R A -3.1224
22 F A -1.8545
23 A A 0.0000
24 V A 0.0000
25 D A -3.2986
26 E A -2.9669
27 H A -3.0342
28 N A -3.0313
29 K A -3.9468
30 K A -4.1927
31 E A -3.8688
32 N A -3.1473
33 A A -1.8888
34 L A -0.3644
35 L A 0.0000
36 E A -2.8880
37 F A -1.9743
38 V A -1.3435
39 R A -2.1824
40 V A 0.0000
41 V A -0.9202
42 K A -2.2125
43 A A 0.0000
44 K A -1.4892
45 E A -0.8044
46 Q A -0.1236
47 I A 0.0292
48 D A 0.1569
49 L A 0.7905
50 T A -0.0117
51 Q A -0.7495
52 S A -0.2135
53 F A 0.1940
54 D A -1.0681
55 M A -0.1136
56 T A 0.0000
57 M A -0.4354
58 Y A -0.0098
59 Y A -0.6618
60 L A 0.0000
61 T A -1.1492
62 L A 0.0000
63 E A -1.8759
64 A A 0.0000
65 K A -3.1606
66 D A -2.9738
67 G A -2.1479
68 G A -2.8001
69 K A -3.7919
70 K A -3.4206
71 K A -2.4215
72 L A -1.0278
73 Y A 0.0000
74 E A -1.4707
75 A A 0.0000
76 K A -1.5311
77 V A 0.0000
78 W A -0.7928
79 V A -0.5043
80 K A -0.8756
81 P A -0.4538
82 I A 0.4046
83 D A -1.1650
84 S A -0.7269
85 N A -0.7816
86 F A 1.0394
87 T A 0.3133
88 G A -0.1592
89 T A -0.2850
90 N A -0.8939
91 F A -0.4818
92 K A -1.4974
93 E A -1.9758
94 L A -1.7359
95 Q A -2.0242
96 E A -2.0681
97 F A -1.4567
98 K A -1.5999
99 P A -1.0877
100 V A -0.5108
101 G A -1.2902
102 D A -1.8459
103 A A -0.8386
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018