Project name: mut_MPZ_01 [mutate: DV105A]

Status: done

Started: 2026-02-20 15:24:26
Settings
Chain sequence(s) A: IVVYTDREVHGAVGSRVTLHHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues DV105A
Energy difference between WT (input) and mutated protein (by FoldX) 1.56102 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:01:56)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:02:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:59)
Show buried residues

Minimal score value
-3.6778
Maximal score value
3.0778
Average score
-0.6946
Total score value
-84.046

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A 1.9328
2 V A 1.8823
3 V A 1.0332
4 Y A 0.3211
5 T A -1.5362
6 D A -3.2763
7 R A -3.6778
8 E A -3.1663
9 V A -1.6110
10 H A -0.6175
11 G A 0.0000
12 A A -0.8372
13 V A -1.1203
14 G A -1.7462
15 S A -1.8810
16 R A -2.5283
17 V A -1.1506
18 T A -0.7226
19 L A 0.0000
20 H A -1.0790
21 C A 0.0000
22 S A 0.4666
23 F A 0.0000
24 W A 1.9640
25 S A 1.0085
26 S A -0.1154
27 E A -0.8467
28 W A 0.3033
29 V A -0.0236
30 S A -1.2641
31 D A -2.9197
32 D A -2.6717
33 I A 0.0000
34 S A -1.4439
35 F A 0.0000
36 T A 0.0000
37 W A 0.0000
38 R A -1.1440
39 Y A 0.0000
40 Q A -2.0897
41 P A -2.0248
42 E A -2.5058
43 G A -2.1682
44 G A -2.5509
45 R A -3.2134
46 D A -2.8402
47 A A -1.4440
48 I A -0.5217
49 S A -0.4617
50 I A 0.0000
51 F A 0.0000
52 H A -0.2513
53 Y A 0.0000
54 A A -1.7117
55 K A -2.7371
56 G A -2.4047
57 Q A -1.6500
58 P A -0.4047
59 Y A 0.5504
60 I A 0.1462
61 D A -1.0239
62 E A -1.7643
63 V A 0.1693
64 G A -0.3190
65 T A -0.5751
66 F A 0.0000
67 K A -2.1273
68 E A -2.7881
69 R A -2.2798
70 I A -1.3278
71 Q A -0.5794
72 W A 0.4220
73 V A 0.5485
74 G A -0.1417
75 D A -0.7911
76 P A -1.8651
77 R A -2.1546
78 W A -0.1948
79 K A -0.7054
80 D A -0.3002
81 G A 0.0000
82 S A 0.0000
83 I A 0.0000
84 V A 0.0000
85 I A 0.0000
86 H A -2.1882
87 N A -2.5525
88 L A 0.0000
89 D A -1.2780
90 Y A 0.5942
91 S A -0.1805
92 D A 0.0000
93 N A -0.4792
94 G A 0.0000
95 T A -1.5727
96 F A 0.0000
97 T A -1.0528
98 C A 0.0000
99 D A -0.9928
100 V A 0.0000
101 K A -0.1863
102 N A -0.5212
103 P A -0.2933
104 P A 0.4692
105 V A 2.1998 mutated: DV105A
106 I A 3.0778
107 V A 2.4003
108 G A 0.4720
109 K A -0.8703
110 T A -0.8165
111 S A -1.1270
112 Q A -2.2098
113 V A 0.0000
114 T A -1.8685
115 L A 0.0000
116 Y A 0.2541
117 V A 0.0000
118 F A -0.0804
119 E A -1.7699
120 K A -1.5364
121 V A 0.6116
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018