Project name: 519e9555c9f34ba

Status: done

Started: 2026-04-01 22:31:23
Settings
Chain sequence(s) A: KIPGVKPIRLFFGQQRRDVYPSALRRLLRFIAPDLVITHMEAHVNEATGRGKGCAWVIVPSVLEAKRLLRLSGRIFLDINSNGEEVYLFAPPNCREWLSEYADYVVSSTTRASHLPYLPMVVGVPKKECIYVRELLAPYIYDPNRGDCPPYADAVSEFKGLLEDHAS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:17)
Show buried residues

Minimal score value
-3.6037
Maximal score value
1.5159
Average score
-0.6642
Total score value
-110.9281

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -0.4293
2 I A 1.3919
3 P A 1.1856
4 G A 0.7494
5 V A 1.0544
6 K A -0.8254
7 P A -0.8235
8 I A 0.0000
9 R A -0.8974
10 L A 0.0000
11 F A 0.4238
12 F A 0.0000
13 G A 0.0000
14 Q A -0.1876
15 Q A 0.0000
16 R A -1.7064
17 R A -2.7837
18 D A -1.4399
19 V A -0.6122
20 Y A 0.4156
21 P A -0.6929
22 S A -1.3838
23 A A -1.6384
24 L A 0.0000
25 R A -2.8120
26 R A -2.2700
27 L A 0.0000
28 L A 0.0000
29 R A -1.7454
30 F A 0.4691
31 I A 0.3922
32 A A -0.4663
33 P A -0.9635
34 D A -1.4874
35 L A 0.0000
36 V A 1.2367
37 I A 0.2219
38 T A 0.0343
39 H A -1.2625
40 M A 0.0000
41 E A -1.5855
42 A A 0.0000
43 H A -1.3372
44 V A -1.5754
45 N A -2.0896
46 E A -2.4522
47 A A -1.2600
48 T A -1.4555
49 G A -1.9046
50 R A -2.7599
51 G A 0.0000
52 K A -2.7251
53 G A 0.0000
54 C A -0.8473
55 A A 0.0000
56 W A -0.5664
57 V A 0.0000
58 I A -0.4908
59 V A 0.0000
60 P A 0.1961
61 S A 0.5745
62 V A 0.9540
63 L A 1.5159
64 E A 0.6719
65 A A 0.0000
66 K A -0.1202
67 R A -0.5527
68 L A 0.0000
69 L A 0.0000
70 R A -1.1628
71 L A 0.0000
72 S A 0.0000
73 G A -0.2580
74 R A -0.4795
75 I A 0.0000
76 F A 0.0000
77 L A 0.0000
78 D A 0.0000
79 I A -0.1840
80 N A -1.1616
81 S A -1.0274
82 N A -1.7266
83 G A -1.2824
84 E A -1.4690
85 E A -0.9339
86 V A 0.0000
87 Y A 0.0000
88 L A 0.0000
89 F A -0.2078
90 A A 0.0000
91 P A -0.3465
92 P A -1.5739
93 N A -2.5389
94 C A 0.0000
95 R A -2.1454
96 E A -2.8989
97 W A -1.7315
98 L A 0.0000
99 S A -1.2028
100 E A -2.1997
101 Y A -0.8008
102 A A 0.0000
103 D A -1.1992
104 Y A 0.1388
105 V A 0.0000
106 V A 0.3742
107 S A -0.0847
108 S A -0.1794
109 T A 0.0676
110 T A -0.2312
111 R A -0.0146
112 A A -0.1002
113 S A -0.6490
114 H A -1.4415
115 L A 0.0000
116 P A 0.0000
117 Y A 1.3645
118 L A 1.1191
119 P A 0.0000
120 M A 0.0000
121 V A 0.7791
122 V A 0.0000
123 G A -0.1368
124 V A 0.0000
125 P A -1.4032
126 K A -2.3557
127 K A -2.3116
128 E A -1.3686
129 C A -0.0846
130 I A 1.0338
131 Y A 0.9336
132 V A 0.0000
133 R A -0.9328
134 E A -1.2269
135 L A 0.0230
136 L A 0.0000
137 A A -0.3056
138 P A -0.1789
139 Y A 0.0932
140 I A 0.3186
141 Y A -0.4781
142 D A -2.0129
143 P A -2.4232
144 N A -3.1785
145 R A -3.6037
146 G A -3.0056
147 D A -3.0387
148 C A -1.4007
149 P A -0.4329
150 P A -0.3450
151 Y A 0.6658
152 A A -0.4292
153 D A -1.5207
154 A A -0.6325
155 V A -0.5232
156 S A -1.2794
157 E A -2.2860
158 F A -1.1800
159 K A -2.1450
160 G A -1.6381
161 L A 0.0000
162 L A -2.1623
163 E A -3.2086
164 D A -2.8620
165 H A -1.9925
166 A A -0.9619
167 S A -0.9001
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018