Project name: query_structure

Chain sequence(s)	A: GPSQGQLVESGGGLVQPGGSLRLSSAASGFTLDYYAIGWFRQAPGKEREGVSSISNSGGSTKYADSVKGRFTISRDKAKNTVYLQMNSLKPEDTGVYYSAADRGYSEYDLPSDLVIYGMDYWGKGTPVTVSA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)

• Minimal score value: -3.5072
• Maximal score value: 1.2261
• Average score: -0.7601
• Total score value: -100.3321

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.8296
2	P	A	-0.9651
3	S	A	-1.3449
4	Q	A	-1.7698
5	G	A	-1.1644
6	Q	A	-1.4275
7	L	A	0.0000
8	V	A	0.6578
9	E	A	0.0000
10	S	A	-0.4249
11	G	A	-1.1511
12	G	A	-0.4975
13	G	A	0.2392
14	L	A	1.2048
15	V	A	0.0480
16	Q	A	-1.2254
17	P	A	-1.5366
18	G	A	-1.4702
19	G	A	-1.0391
20	S	A	-1.3069
21	L	A	-1.1269
22	R	A	-2.3492
23	L	A	0.0000
24	S	A	-0.4917
25	S	A	0.0000
26	A	A	-0.2049
27	A	A	-0.2993
28	S	A	-0.6678
29	G	A	-1.0692
30	F	A	-0.3028
31	T	A	-0.3347
32	L	A	0.0000
33	D	A	-0.5364
34	Y	A	0.6690
35	Y	A	0.0000
36	A	A	-0.2580
37	I	A	0.0000
38	G	A	0.0000
39	W	A	0.0000
40	F	A	0.0000
41	R	A	0.0000
42	Q	A	-1.9410
43	A	A	-1.8013
44	P	A	-1.3160
45	G	A	-1.7995
46	K	A	-2.9555
47	E	A	-3.5072
48	R	A	-3.0160
49	E	A	-1.7659
50	G	A	-1.1711
51	V	A	0.0000
52	S	A	0.0000
53	S	A	0.0000
54	I	A	0.0000
55	S	A	-0.7326
56	N	A	-0.8453
57	S	A	-0.9804
58	G	A	-1.0793
59	G	A	-0.9806
60	S	A	-1.3390
61	T	A	-1.1022
62	K	A	-2.2859
63	Y	A	-1.7266
64	A	A	-1.7881
65	D	A	-2.6762
66	S	A	-1.8678
67	V	A	0.0000
68	K	A	-2.8614
69	G	A	-1.8641
70	R	A	-1.7372
71	F	A	0.0000
72	T	A	-1.2685
73	I	A	0.0000
74	S	A	-0.7436
75	R	A	-1.4640
76	D	A	-2.2161
77	K	A	-2.8529
78	A	A	-1.9555
79	K	A	-2.5801
80	N	A	-1.9618
81	T	A	0.0000
82	V	A	0.0000
83	Y	A	-0.7677
84	L	A	0.0000
85	Q	A	-1.7171
86	M	A	0.0000
87	N	A	-2.0110
88	S	A	-1.4585
89	L	A	0.0000
90	K	A	-2.3471
91	P	A	-1.7628
92	E	A	-2.2897
93	D	A	0.0000
94	T	A	-0.7223
95	G	A	0.0000
96	V	A	-0.3048
97	Y	A	0.0000
98	Y	A	-0.2770
99	S	A	0.0000
100	A	A	0.0000
101	A	A	0.0000
102	D	A	-1.1946
103	R	A	-1.8137
104	G	A	-0.3813
105	Y	A	0.8247
106	S	A	-0.4112
107	E	A	-1.2796
108	Y	A	0.2902
109	D	A	-0.9545
110	L	A	0.8881
111	P	A	0.0517
112	S	A	-0.4937
113	D	A	-0.7851
114	L	A	1.2248
115	V	A	0.9150
116	I	A	0.9254
117	Y	A	1.2261
118	G	A	-0.2535
119	M	A	0.0000
120	D	A	-2.0593
121	Y	A	-1.0707
122	W	A	-0.1988
123	G	A	-0.3642
124	K	A	-1.3721
125	G	A	0.0000
126	T	A	0.0000
127	P	A	-0.0737
128	V	A	0.0000
129	T	A	-0.0169
130	V	A	0.0000
131	S	A	-0.5207
132	A	A	-0.6187