Project name: query_structure

Status: done

Started: 2026-03-17 01:11:25
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVFFYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYALYRSQKSGQYDYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:37)
Show buried residues

Minimal score value
-3.4574
Maximal score value
1.774
Average score
-0.612
Total score value
-58.7518

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7740
2 S A 0.5915
3 D A -0.0286
4 V A -0.0250
5 P A 0.0000
6 R A -3.2226
7 D A -3.4574
8 L A 0.0000
9 E A -2.1317
10 V A 0.0966
11 V A 1.5264
12 A A 0.8705
13 A A 0.2994
14 T A -0.3448
15 P A -1.0530
16 T A -0.9625
17 S A -0.5439
18 L A 0.0000
19 L A 0.6466
20 I A 0.0000
21 S A -1.1755
22 W A 0.0000
23 D A -3.2347
24 A A -1.6265
25 P A -0.3568
26 A A 0.4326
27 V A 0.3929
28 T A 0.1707
29 V A 0.6450
30 F A 1.2638
31 F A 1.7458
32 Y A 0.0000
33 F A 0.9132
34 I A 0.0000
35 T A 0.0000
36 Y A -0.2959
37 G A 0.0000
38 E A -1.8300
39 T A -1.5076
40 G A -1.3582
41 G A -1.5815
42 N A -1.6194
43 S A -0.9609
44 P A -0.4118
45 V A 0.2905
46 Q A -0.8422
47 K A -1.3514
48 F A -0.3490
49 T A 0.3958
50 V A 0.0000
51 P A 0.0964
52 G A 0.2951
53 S A -0.6576
54 K A -1.6367
55 S A -1.2303
56 T A -0.7365
57 A A 0.0000
58 T A 0.0228
59 I A 0.0000
60 S A -0.6706
61 G A -1.0238
62 L A 0.0000
63 K A -2.3939
64 P A -1.6284
65 G A -1.3724
66 V A -1.6031
67 D A -2.6821
68 Y A 0.0000
69 T A -0.9395
70 I A 0.0000
71 T A 0.0000
72 V A 0.0000
73 Y A 0.8018
74 A A 0.0000
75 L A 1.0270
76 Y A -0.2189
77 R A -2.3076
78 S A 0.0000
79 Q A -2.8183
80 K A -2.8915
81 S A -2.2201
82 G A -2.2612
83 Q A -2.2649
84 Y A -0.7479
85 D A -1.3127
86 Y A 0.5817
87 S A 0.0000
88 S A -0.0792
89 P A -0.0280
90 I A -0.3307
91 S A -0.7412
92 I A -0.7379
93 N A -1.8752
94 Y A -1.6488
95 R A -2.7418
96 T A -1.5602
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018