Project name: 52b4d2e79496a7

Status: done

Started: 2026-04-24 02:56:22
Settings
Chain sequence(s) A: MHHHHHHDVVVRHRHRHKHKREGTFTSDVSSYLEGQAAKEFIAWLVRGRGLKRDVVVRHRHRHKHKREGTFTSDVSSYLEGQAAKEFIAWLVRGRGLKRDVVVRHRHRHKHKREGTFTSDVSSYLEGQAAKEFIAWLVRGRGLKRDVVVRHRHRHKHKREGTFTSDVSSYLEGQAAKEFIAWLVRGRGLKRDVVVRHRHRHKHKREGTFTSDVSSYLEGQAAKEFIAWLVRGRGLKR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:10:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:16)
Show buried residues

Minimal score value
-4.8176
Maximal score value
2.2624
Average score
-1.6819
Total score value
-398.6029

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3467
2 H A -1.3102
3 H A -2.0272
4 H A -2.5645
5 H A -2.4973
6 H A -2.4469
7 H A -2.0797
8 D A -0.8733
9 V A 1.6489
10 V A 2.2624
11 V A 1.5078
12 R A -1.3915
13 H A -2.5543
14 R A -3.7293
15 H A -3.6750
16 R A -3.9510
17 H A -3.7115
18 K A -3.9426
19 H A -4.1480
20 K A -4.2195
21 R A -4.3217
22 E A -3.1469
23 G A -1.9723
24 T A -0.6344
25 F A 0.8561
26 T A 0.1264
27 S A -0.3367
28 D A -0.7370
29 V A 0.6883
30 S A 0.1831
31 S A -0.1880
32 Y A 1.0015
33 L A 0.8931
34 E A -0.8541
35 G A -0.6664
36 Q A -1.0700
37 A A -0.9522
38 A A -0.9980
39 K A -2.1375
40 E A -2.1249
41 F A -0.4791
42 I A 0.0000
43 A A -1.2391
44 W A -0.9845
45 L A 0.0000
46 V A -1.2166
47 R A -2.1070
48 G A -2.4283
49 R A -2.9308
50 G A 0.0000
51 L A -2.8118
52 K A -3.7257
53 R A -3.8274
54 D A -2.7297
55 V A -0.1666
56 V A 1.2704
57 V A 1.1357
58 R A -1.6065
59 H A -2.4038
60 R A -3.1607
61 H A -3.4984
62 R A -3.5781
63 H A -4.1599
64 K A -3.7637
65 H A -3.9282
66 K A -4.1420
67 R A -4.3174
68 E A -4.0155
69 G A -1.8217
70 T A -1.1136
71 F A -0.6197
72 T A 0.0000
73 S A 0.1291
74 D A -0.0801
75 V A 0.4020
76 S A 0.1504
77 S A -0.5745
78 Y A -0.5257
79 L A -1.4306
80 E A -2.3966
81 G A -2.2614
82 Q A -2.7722
83 A A -2.3322
84 A A -1.9107
85 K A -3.0828
86 E A -2.6624
87 F A -1.2271
88 I A -1.2153
89 A A -1.7467
90 W A 0.0000
91 L A 0.0000
92 V A -1.5003
93 R A -2.5271
94 G A -2.1581
95 R A -2.7788
96 G A -2.0152
97 L A -2.3118
98 K A -3.8596
99 R A -4.3118
100 D A -2.7562
101 V A -0.0671
102 V A 0.8511
103 V A 0.0755
104 R A -2.2692
105 H A -2.8470
106 R A -4.1798
107 H A -4.8176
108 R A -3.8559
109 H A -4.0592
110 K A -3.7356
111 H A -4.0202
112 K A -4.1051
113 R A -4.1855
114 E A -3.2278
115 G A -1.3322
116 T A 0.0000
117 F A 0.2229
118 T A 0.7586
119 S A 0.4730
120 D A 0.0000
121 V A 0.7059
122 S A 0.3571
123 S A 0.3592
124 Y A 0.8393
125 L A -0.8267
126 E A -2.0363
127 G A -2.0294
128 Q A -2.5465
129 A A -1.9759
130 A A -1.6305
131 K A -2.6987
132 E A -1.8477
133 F A -0.8022
134 I A -0.8313
135 A A -1.2392
136 W A 0.0000
137 L A -0.5562
138 V A -1.1019
139 R A -2.1904
140 G A -1.9881
141 R A -2.1787
142 G A 0.0000
143 L A -1.9017
144 K A -3.7188
145 R A -3.9148
146 D A -1.7759
147 V A 0.5421
148 V A 1.1199
149 V A 0.7963
150 R A -1.2749
151 H A -3.2128
152 R A -4.2117
153 H A -4.5266
154 R A -4.1857
155 H A -4.0241
156 K A -3.5403
157 H A -3.7835
158 K A -4.3558
159 R A -4.2934
160 E A -3.5632
161 G A -2.1703
162 T A -0.3970
163 F A 0.7305
164 T A 0.3343
165 S A -0.0082
166 D A 0.2195
167 V A 0.4049
168 S A 0.1058
169 S A 0.1477
170 Y A 0.6359
171 L A -1.0118
172 E A -2.1211
173 G A -2.2009
174 Q A -2.7518
175 A A -2.1759
176 A A -1.8044
177 K A -3.0685
178 E A -2.4521
179 F A 0.0000
180 I A -0.9593
181 A A -1.6655
182 W A 0.0000
183 L A -0.9707
184 V A -1.4162
185 R A -2.5027
186 G A -2.5154
187 R A -3.0411
188 G A -2.1017
189 L A -2.1383
190 K A -3.5596
191 R A -3.3030
192 D A -1.9933
193 V A 1.0814
194 V A 1.7415
195 V A 1.5554
196 R A -1.6823
197 H A -2.7975
198 R A -3.5047
199 H A -3.8256
200 R A -3.6652
201 H A -3.8733
202 K A -3.6155
203 H A -3.6740
204 K A -4.1585
205 R A -4.2725
206 E A -3.4359
207 G A -2.1184
208 T A -0.9490
209 F A 0.1066
210 T A -0.0560
211 S A -0.3585
212 D A -0.9552
213 V A 0.0000
214 S A -0.5728
215 S A -0.2995
216 Y A 0.5179
217 L A 0.0000
218 E A -2.2663
219 G A -2.4580
220 Q A -2.8279
221 A A -2.2567
222 A A -2.0367
223 K A -3.1166
224 E A -2.6943
225 F A 0.0000
226 I A -0.3006
227 A A -0.8430
228 W A -1.2311
229 L A 0.0000
230 V A 0.4759
231 R A -1.5958
232 G A -2.1119
233 R A -2.7347
234 G A -1.3064
235 L A -1.1303
236 K A -2.7680
237 R A -2.6015
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018