Project name: GPGP

Chain sequence(s)	A: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:32)

• Minimal score value: -1.7758
• Maximal score value: 1.9363
• Average score: -0.2325
• Total score value: -6.9753

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	H	A	-1.3159
2	A	A	-0.8596
3	E	A	-1.7758
4	G	A	-1.0436
5	T	A	-0.5350
6	F	A	0.4850
7	T	A	-0.1246
8	S	A	-0.4193
9	D	A	-0.9286
10	V	A	0.5201
11	S	A	-0.0025
12	S	A	-0.2178
13	Y	A	0.8107
14	L	A	0.6289
15	E	A	-1.2886
16	G	A	-0.8937
17	Q	A	-0.9523
18	A	A	-0.7107
19	A	A	-0.6253
20	K	A	-1.4737
21	E	A	-0.8349
22	F	A	1.2981
23	I	A	1.9363
24	A	A	0.8148
25	W	A	0.8249
26	L	A	1.2111
27	V	A	1.5221
28	K	A	-0.6732
29	G	A	-1.1544
30	R	A	-1.1978