Project name: 53251e1576dc38c

Status: done

Started: 2026-07-02 06:26:52
Settings
Chain sequence(s) A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKPEEELVKANSWNQFLQSGKKVSEYARKKLAATERTYGLRFKDQRVHVVSKSERVKMPKKKKEEDIRKLVTMYPDNITIAEERKKRLSFFTGFDSVEHGPGPGTPSIQAIVPLLVPEEGPGPGMWIFLLSNKLSGHSVGPGPGKGEVVVNGRIAYVPQAAYRVKVKSMSKGPGPGSVIPMLMSFGPGPGHLSFLTFSW
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:44)
Show buried residues

Minimal score value
-4.7419
Maximal score value
5.775
Average score
-0.2636
Total score value
-69.8555

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3687
2 R A 0.5267
3 V A 2.7555
4 L A 3.3101
5 Y A 3.2418
6 L A 3.6114
7 L A 4.1248
8 F A 4.5908
9 S A 4.4441
10 F A 5.4290
11 L A 5.3608
12 F A 5.7750
13 I A 5.7056
14 F A 5.5369
15 L A 4.8789
16 M A 3.8826
17 P A 2.1028
18 L A 2.7545
19 P A 1.0748
20 G A 1.1322
21 V A 2.5194
22 F A 2.4332
23 G A 0.6507
24 G A 0.2971
25 I A 0.0255
26 G A -0.4217
27 D A -0.4806
28 P A 0.5268
29 V A 1.3684
30 T A 0.1916
31 C A 0.0000
32 L A 1.2206
33 K A -0.6085
34 S A -0.2501
35 G A -0.6330
36 A A 0.0000
37 I A 0.5957
38 C A 0.9062
39 H A 0.3505
40 P A 0.9080
41 V A 1.9925
42 F A 1.5168
43 C A -0.4153
44 P A -1.4261
45 R A -2.8174
46 R A -3.3119
47 Y A -2.6704
48 K A -2.8569
49 Q A -1.6620
50 I A -0.6950
51 G A -0.6976
52 T A -0.7616
53 C A 0.0000
54 G A -0.2403
55 L A 0.7388
56 P A 0.2614
57 G A 0.3249
58 T A 0.4196
59 K A -0.1871
60 C A 0.0000
61 C A 0.0000
62 K A -1.9266
63 K A -3.0859
64 P A -2.5615
65 E A -2.6005
66 A A -1.5608
67 A A -1.7870
68 K A -2.9932
69 P A -2.8616
70 E A -3.7096
71 E A -3.1260
72 E A -2.2941
73 L A 0.0698
74 V A 0.7347
75 K A -0.8908
76 A A -0.7654
77 N A -1.7885
78 S A -0.8213
79 W A 0.0765
80 N A -1.5048
81 Q A -1.6364
82 F A -0.2274
83 L A -0.5901
84 Q A -1.6531
85 S A -1.5674
86 G A -1.8196
87 K A -2.5083
88 K A -2.7167
89 V A -1.1395
90 S A -1.5916
91 E A -2.5523
92 Y A -0.9848
93 A A -1.7266
94 R A -3.1552
95 K A -3.2108
96 K A -2.8411
97 L A -1.5118
98 A A -1.7095
99 A A -1.6207
100 T A -1.0523
101 E A -0.8393
102 R A -1.8861
103 T A -0.3391
104 Y A 0.6891
105 G A -0.0517
106 L A 0.8001
107 R A -0.7528
108 F A -0.6578
109 K A -2.7738
110 D A -3.3609
111 Q A -2.8511
112 R A -2.3958
113 V A 0.5121
114 H A 0.4702
115 V A 2.2868
116 V A 1.6692
117 S A -0.0489
118 K A -1.9531
119 S A -2.0661
120 E A -3.0800
121 R A -2.4688
122 V A -0.2313
123 K A -1.3620
124 M A -0.2895
125 P A -1.4511
126 K A -3.2079
127 K A -3.8792
128 K A -4.4493
129 K A -4.7419
130 E A -4.5864
131 E A -4.3858
132 D A -3.3580
133 I A -2.0526
134 R A -3.0831
135 K A -2.1994
136 L A 0.3303
137 V A 0.3134
138 T A 0.1465
139 M A 1.0640
140 Y A 1.0487
141 P A -0.1569
142 D A -1.7536
143 N A -1.1011
144 I A 0.5512
145 T A 0.3839
146 I A 1.3290
147 A A -0.6056
148 E A -2.7932
149 E A -3.9409
150 R A -4.6347
151 K A -4.3150
152 K A -3.8606
153 R A -2.4191
154 L A 0.4048
155 S A 1.2833
156 F A 2.8956
157 F A 3.1347
158 T A 1.4433
159 G A 0.7632
160 F A 1.2564
161 D A -0.8258
162 S A -0.3826
163 V A 0.2205
164 E A -1.8766
165 H A -1.7917
166 G A -1.4644
167 P A -1.2595
168 G A -1.0864
169 P A -0.8094
170 G A -0.8515
171 T A -0.3484
172 P A -0.1188
173 S A 0.0605
174 I A 1.4798
175 Q A 0.4260
176 A A 1.5862
177 I A 3.3380
178 V A 3.4066
179 P A 2.7318
180 L A 3.3509
181 L A 2.8193
182 V A 1.4593
183 P A -0.5941
184 E A -2.4311
185 E A -2.9044
186 G A -2.1418
187 P A -1.3228
188 G A -1.2285
189 P A -0.9442
190 G A 0.0364
191 M A 1.5517
192 W A 2.1256
193 I A 2.6832
194 F A 2.4270
195 L A 1.9193
196 L A 1.4373
197 S A -0.1708
198 N A -1.3279
199 K A -1.6611
200 L A -0.2284
201 S A -0.5607
202 G A -0.5088
203 H A -0.0447
204 S A 0.3391
205 V A 1.2390
206 G A -0.1016
207 P A -0.6971
208 G A -1.0809
209 P A -1.1027
210 G A -1.5740
211 K A -1.8585
212 G A -0.6121
213 E A -0.0629
214 V A 0.8367
215 V A 0.7401
216 V A -0.2465
217 N A -1.5891
218 G A -1.2679
219 R A -1.4663
220 I A 0.3667
221 A A 0.8716
222 Y A 0.9391
223 V A 0.5433
224 P A -0.3771
225 Q A -1.2454
226 A A -0.3820
227 A A -0.1056
228 Y A -0.3526
229 R A -1.5549
230 V A -0.8751
231 K A -1.8745
232 V A -0.5382
233 K A -1.3650
234 S A -0.8447
235 M A -0.1241
236 S A -1.0562
237 K A -1.7994
238 G A -1.1713
239 P A -1.0079
240 G A -1.3595
241 P A -0.9491
242 G A -0.8018
243 S A -0.0204
244 V A 1.3731
245 I A 1.6454
246 P A 1.5213
247 M A 1.7557
248 L A 1.6357
249 M A 1.3230
250 S A 0.7824
251 F A 0.3930
252 G A -0.7281
253 P A -0.9364
254 G A -1.0353
255 P A -1.2198
256 G A -1.5903
257 H A -1.1972
258 L A -0.0438
259 S A 0.6041
260 F A 1.7946
261 L A 1.8327
262 T A 1.7745
263 F A 2.5448
264 S A 1.5952
265 W A 1.8340
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018