Project name: query_structure

Status: done

Started: 2026-03-17 01:22:16
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGNSPVQEFTVPGSKSTATISGLSPGVDYTITVYAWVSDEYTHGYYSYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.6938
Maximal score value
1.7677
Average score
-0.4364
Total score value
-41.8967

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7677
2 S A 0.7761
3 S A 0.6296
4 V A 0.2393
5 P A 0.0000
6 T A -1.6605
7 K A -2.6484
8 L A 0.0000
9 E A -1.9446
10 V A 0.0841
11 V A 1.5254
12 A A 0.8943
13 A A 0.3089
14 T A -0.1904
15 P A -0.7997
16 T A -0.5312
17 S A -0.3142
18 L A 0.0000
19 L A 0.7551
20 I A 0.0000
21 S A -0.9552
22 W A 0.0000
23 D A -2.6938
24 A A -1.2441
25 P A 0.0440
26 A A 0.4379
27 V A 0.5687
28 T A -0.1704
29 V A -0.4545
30 D A -1.5152
31 H A -1.0191
32 Y A 0.0000
33 V A 0.0258
34 I A 0.0000
35 T A -0.3491
36 Y A -0.2878
37 G A 0.0000
38 E A -1.4684
39 T A -1.4095
40 G A -1.3272
41 G A -1.4409
42 N A -1.5445
43 S A -0.8378
44 P A -0.3007
45 V A 0.4847
46 Q A -0.7589
47 E A -1.4722
48 F A -0.5094
49 T A -0.1277
50 V A 0.0000
51 P A -1.1746
52 G A -1.3492
53 S A -1.3804
54 K A -1.9732
55 S A -1.4115
56 T A -0.7347
57 A A 0.0000
58 T A 0.2983
59 I A 0.0000
60 S A -0.4705
61 G A -0.6860
62 L A 0.0000
63 S A -0.9007
64 P A -1.0593
65 G A -1.1906
66 V A -1.1820
67 D A -2.3850
68 Y A 0.0000
69 T A -0.8573
70 I A 0.0000
71 T A -0.0212
72 V A 0.0000
73 Y A 0.7914
74 A A 0.0000
75 W A 0.6290
76 V A 0.2187
77 S A -0.5501
78 D A -0.7573
79 E A -1.6230
80 Y A -0.0386
81 T A -0.2845
82 H A -1.1041
83 G A -0.1195
84 Y A 0.7092
85 Y A 1.7016
86 S A 1.1411
87 Y A 0.9311
88 S A 0.2702
89 P A 0.2649
90 I A 0.1636
91 S A -0.3238
92 I A -0.7251
93 N A -1.8407
94 Y A -1.5934
95 R A -2.5498
96 T A -1.2959
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018