Project name: 53914d77dfa474e

Status: done

Started: 2026-06-22 16:07:27
Settings
Chain sequence(s) B: ELRALKDEMIKGLKEQQKISEKLAEANGNEELKKKAKEFHKKLIDKVKKY
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:53)
Show buried residues

Minimal score value
-4.5209
Maximal score value
0.0
Average score
-2.3022
Total score value
-115.1078

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -1.5364
2 L B -0.2323
3 R B -2.1424
4 A B -1.5362
5 L B -0.7922
6 K B -2.0589
7 D B -3.3903
8 E B -2.9749
9 M B -1.9399
10 I B -2.8539
11 K B -3.6355
12 G B -2.9082
13 L B -2.4321
14 K B -3.5731
15 E B -3.5036
16 Q B -2.7757
17 Q B 0.0000
18 K B -2.4836
19 I B -0.8785
20 S B -1.3617
21 E B 0.0000
22 K B -2.0314
23 L B -0.2876
24 A B 0.0000
25 E B -3.2863
26 A B -1.8962
27 N B -2.4530
28 G B -2.7670
29 N B -3.5170
30 E B -4.5209
31 E B -4.2805
32 L B -3.2640
33 K B -4.2346
34 K B -4.3034
35 K B -3.8299
36 A B 0.0000
37 K B -3.4966
38 E B -2.9837
39 F B -1.2556
40 H B 0.0000
41 K B -3.0648
42 K B -3.1226
43 L B -1.9687
44 I B 0.0000
45 D B -3.5765
46 K B -3.0713
47 V B -2.1872
48 K B -3.5173
49 K B -2.6099
50 Y B -0.5724
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018