| Chain sequence(s) |
A: EVQLVESGGGLEQPGGSLRLSCAGSGFDLSKGAMTWVRQAPGKGLEWVSSITRSGKGTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCALTNSLTSSGIGIGSMYGWGQGTTVTVSSAS
B: DIVMTQSPLSLPVTPGEPASISSKTSTSTTDSYGNSYVGWYLQKSGQSPQLLIYRASIRAGGVPDRFSGSGSGTDFTLKISRVEAEDVGFYYVVDTKTYPIGFGQGTKLEIKRTV input PDB |
| Selected Chain(s) | A,B |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with all chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:01:47)
[INFO] Auto_mut: Residue number 107 from chain A and a score of 1.933 (isoleucine) selected
for automated muatation (00:01:48)
[INFO] Auto_mut: Residue number 102 from chain A and a score of 1.059 (leucine) selected for
automated muatation (00:01:48)
[INFO] Auto_mut: Residue number 3 from chain B and a score of 1.046 (valine) selected for
automated muatation (00:01:48)
[INFO] Auto_mut: Residue number 115 from chain B and a score of 0.989 (valine) selected for
automated muatation (00:01:48)
[INFO] Auto_mut: Residue number 11 from chain A and a score of 0.837 (leucine) selected for
automated muatation (00:01:48)
[INFO] Auto_mut: Residue number 33 from chain B and a score of 0.822 (tyrosine) selected for
automated muatation (00:01:48)
[INFO] Auto_mut: Mutating residue number 107 from chain A (isoleucine) into glutamic acid (00:01:48)
[INFO] Auto_mut: Mutating residue number 107 from chain A (isoleucine) into aspartic acid (00:01:48)
[INFO] Auto_mut: Mutating residue number 102 from chain A (leucine) into glutamic acid (00:01:48)
[INFO] Auto_mut: Mutating residue number 102 from chain A (leucine) into lysine (00:02:40)
[INFO] Auto_mut: Mutating residue number 107 from chain A (isoleucine) into arginine (00:02:40)
[INFO] Auto_mut: Mutating residue number 107 from chain A (isoleucine) into lysine (00:02:43)
[INFO] Auto_mut: Mutating residue number 102 from chain A (leucine) into aspartic acid (00:03:37)
[INFO] Auto_mut: Mutating residue number 3 from chain B (valine) into glutamic acid (00:03:41)
[INFO] Auto_mut: Mutating residue number 3 from chain B (valine) into aspartic acid (00:03:53)
[INFO] Auto_mut: Mutating residue number 102 from chain A (leucine) into arginine (00:04:28)
[INFO] Auto_mut: Mutating residue number 3 from chain B (valine) into lysine (00:04:36)
[INFO] Auto_mut: Mutating residue number 3 from chain B (valine) into arginine (00:04:42)
[INFO] Auto_mut: Mutating residue number 115 from chain B (valine) into glutamic acid (00:05:27)
[INFO] Auto_mut: Mutating residue number 115 from chain B (valine) into aspartic acid (00:05:35)
[INFO] Auto_mut: Mutating residue number 11 from chain A (leucine) into glutamic acid (00:05:38)
[INFO] Auto_mut: Mutating residue number 115 from chain B (valine) into lysine (00:06:17)
[INFO] Auto_mut: Mutating residue number 115 from chain B (valine) into arginine (00:06:24)
[INFO] Auto_mut: Mutating residue number 11 from chain A (leucine) into lysine (00:06:32)
[INFO] Auto_mut: Mutating residue number 11 from chain A (leucine) into aspartic acid (00:07:09)
[INFO] Auto_mut: Mutating residue number 33 from chain B (tyrosine) into glutamic acid (00:07:17)
[INFO] Auto_mut: Mutating residue number 33 from chain B (tyrosine) into aspartic acid (00:07:30)
[INFO] Auto_mut: Mutating residue number 11 from chain A (leucine) into arginine (00:07:59)
[INFO] Auto_mut: Mutating residue number 33 from chain B (tyrosine) into lysine (00:08:08)
[INFO] Auto_mut: Mutating residue number 33 from chain B (tyrosine) into arginine (00:08:20)
[INFO] Auto_mut: Effect of mutation residue number 107 from chain A (isoleucine) into
glutamic acid: Energy difference: 0.7168 kcal/mol, Difference in average
score from the base case: -0.0533 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 107 from chain A (isoleucine) into
lysine: Energy difference: -0.0374 kcal/mol, Difference in average score
from the base case: -0.0466 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 107 from chain A (isoleucine) into
aspartic acid: Energy difference: 0.9571 kcal/mol, Difference in average
score from the base case: -0.0537 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 107 from chain A (isoleucine) into
arginine: Energy difference: 0.0648 kcal/mol, Difference in average score
from the base case: -0.0547 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (leucine) into glutamic
acid: Energy difference: -0.3953 kcal/mol, Difference in average score from
the base case: -0.0487 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (leucine) into lysine:
Energy difference: -0.0550 kcal/mol, Difference in average score from the
base case: -0.0480 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (leucine) into aspartic
acid: Energy difference: -0.3744 kcal/mol, Difference in average score from
the base case: -0.0544 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 102 from chain A (leucine) into arginine:
Energy difference: -0.3807 kcal/mol, Difference in average score from the
base case: -0.0484 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain B (valine) into glutamic
acid: Energy difference: -0.2381 kcal/mol, Difference in average score from
the base case: -0.0397 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain B (valine) into lysine:
Energy difference: -0.2182 kcal/mol, Difference in average score from the
base case: -0.0399 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain B (valine) into aspartic
acid: Energy difference: 0.0796 kcal/mol, Difference in average score from
the base case: -0.0409 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain B (valine) into arginine:
Energy difference: -0.4023 kcal/mol, Difference in average score from the
base case: -0.0403 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain B (valine) into glutamic
acid: Energy difference: -0.1807 kcal/mol, Difference in average score from
the base case: -0.0276 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain B (valine) into lysine:
Energy difference: -0.1632 kcal/mol, Difference in average score from the
base case: -0.0266 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain B (valine) into aspartic
acid: Energy difference: -0.1781 kcal/mol, Difference in average score from
the base case: -0.0273 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain B (valine) into arginine:
Energy difference: -0.2316 kcal/mol, Difference in average score from the
base case: -0.0238 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 11 from chain A (leucine) into glutamic
acid: Energy difference: 0.5546 kcal/mol, Difference in average score from
the base case: -0.0541 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 11 from chain A (leucine) into lysine:
Energy difference: -0.1008 kcal/mol, Difference in average score from the
base case: -0.0517 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 11 from chain A (leucine) into aspartic
acid: Energy difference: 0.7539 kcal/mol, Difference in average score from
the base case: -0.0537 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 11 from chain A (leucine) into arginine:
Energy difference: -0.2831 kcal/mol, Difference in average score from the
base case: -0.0544 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 33 from chain B (tyrosine) into glutamic
acid: Energy difference: 0.5521 kcal/mol, Difference in average score from
the base case: -0.0357 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 33 from chain B (tyrosine) into lysine:
Energy difference: 0.2539 kcal/mol, Difference in average score from the
base case: -0.0329 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 33 from chain B (tyrosine) into aspartic
acid: Energy difference: 0.5107 kcal/mol, Difference in average score from
the base case: -0.0361 (00:09:15)
[INFO] Auto_mut: Effect of mutation residue number 33 from chain B (tyrosine) into arginine:
Energy difference: -0.0638 kcal/mol, Difference in average score from the
base case: -0.0343 (00:09:15)
[INFO] Main: Simulation completed successfully. (00:09:21)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | E | A | -1.5468 | |
| 2 | V | A | -0.2925 | |
| 3 | Q | A | -0.6704 | |
| 4 | L | A | 0.0000 | |
| 5 | V | A | 0.4312 | |
| 6 | E | A | 0.0000 | |
| 7 | S | A | -0.5610 | |
| 8 | G | A | -1.0798 | |
| 9 | G | A | -0.5013 | |
| 10 | G | A | 0.0667 | |
| 11 | L | A | 0.8367 | |
| 12 | E | A | -0.8142 | |
| 13 | Q | A | -1.7467 | |
| 14 | P | A | -1.9155 | |
| 15 | G | A | -1.6958 | |
| 16 | G | A | -1.3249 | |
| 17 | S | A | -1.7201 | |
| 18 | L | A | -1.2834 | |
| 19 | R | A | -2.3761 | |
| 20 | L | A | 0.0000 | |
| 21 | S | A | -0.5486 | |
| 22 | C | A | 0.0000 | |
| 23 | A | A | -0.2408 | |
| 24 | G | A | -0.5003 | |
| 25 | S | A | -0.6121 | |
| 26 | G | A | -0.8816 | |
| 27 | F | A | -0.6962 | |
| 28 | D | A | -1.5968 | |
| 29 | L | A | 0.0000 | |
| 30 | S | A | -2.0943 | |
| 31 | K | A | -2.2031 | |
| 32 | G | A | -1.3074 | |
| 33 | A | A | 0.0000 | |
| 34 | M | A | 0.0000 | |
| 35 | T | A | 0.0000 | |
| 36 | W | A | 0.0000 | |
| 37 | V | A | 0.0000 | |
| 38 | R | A | 0.0000 | |
| 39 | Q | A | -0.8414 | |
| 40 | A | A | -1.2436 | |
| 41 | P | A | -1.0038 | |
| 42 | G | A | -1.4567 | |
| 43 | K | A | -2.3359 | |
| 44 | G | A | -1.4274 | |
| 45 | L | A | 0.0000 | |
| 46 | E | A | -1.0455 | |
| 47 | W | A | 0.0000 | |
| 48 | V | A | 0.0000 | |
| 49 | S | A | 0.0000 | |
| 50 | S | A | 0.0000 | |
| 51 | I | A | 0.0000 | |
| 52 | T | A | 0.0000 | |
| 53 | R | A | -1.8181 | |
| 54 | S | A | -1.5478 | |
| 55 | G | A | -1.6192 | |
| 56 | K | A | -2.1012 | |
| 57 | G | A | -1.1674 | |
| 58 | T | A | -0.3884 | |
| 59 | Y | A | -0.1023 | |
| 60 | Y | A | -0.8029 | |
| 61 | A | A | 0.0000 | |
| 62 | D | A | -2.6727 | |
| 63 | S | A | -1.7533 | |
| 64 | V | A | 0.0000 | |
| 65 | K | A | -2.6036 | |
| 66 | G | A | -1.8683 | |
| 67 | R | A | -1.9859 | |
| 68 | F | A | 0.0000 | |
| 69 | T | A | -1.0558 | |
| 70 | I | A | 0.0000 | |
| 71 | S | A | -0.5184 | |
| 72 | R | A | -1.1719 | |
| 73 | D | A | -1.6560 | |
| 74 | N | A | -2.4062 | |
| 75 | S | A | -1.7888 | |
| 76 | K | A | -2.4675 | |
| 77 | N | A | -1.9891 | |
| 78 | T | A | 0.0000 | |
| 79 | L | A | 0.0000 | |
| 80 | Y | A | -0.6996 | |
| 81 | L | A | 0.0000 | |
| 82 | Q | A | -1.7807 | |
| 83 | M | A | 0.0000 | |
| 84 | N | A | -2.2453 | |
| 85 | S | A | -1.6312 | |
| 86 | L | A | 0.0000 | |
| 87 | R | A | -2.8912 | |
| 88 | A | A | -1.9919 | |
| 89 | E | A | -2.3739 | |
| 90 | D | A | 0.0000 | |
| 91 | T | A | -0.7962 | |
| 92 | A | A | 0.0000 | |
| 93 | V | A | 0.1081 | |
| 94 | Y | A | 0.0000 | |
| 95 | Y | A | 0.0000 | |
| 96 | C | A | 0.0000 | |
| 97 | A | A | 0.0000 | |
| 98 | L | A | 0.0000 | |
| 99 | T | A | 0.0000 | |
| 100 | N | A | -0.6858 | |
| 101 | S | A | 0.0000 | |
| 102 | L | A | 1.0590 | |
| 103 | T | A | 0.4498 | |
| 104 | S | A | -0.2935 | |
| 105 | S | A | 0.3244 | |
| 106 | G | A | 0.0000 | |
| 107 | I | A | 1.9330 | |
| 108 | G | A | 0.7191 | |
| 109 | I | A | 0.0000 | |
| 110 | G | A | -0.1920 | |
| 111 | S | A | 0.0000 | |
| 112 | M | A | 0.0000 | |
| 113 | Y | A | 0.2273 | |
| 114 | G | A | -0.1125 | |
| 115 | W | A | 0.0000 | |
| 116 | G | A | 0.0000 | |
| 117 | Q | A | -1.3697 | |
| 118 | G | A | 0.0000 | |
| 119 | T | A | -0.2294 | |
| 120 | T | A | -0.0192 | |
| 121 | V | A | 0.0000 | |
| 122 | T | A | -0.2606 | |
| 123 | V | A | 0.0000 | |
| 124 | S | A | -0.9092 | |
| 125 | S | A | -0.8456 | |
| 126 | A | A | -0.2860 | |
| 127 | S | A | -0.3234 | |
| 1 | D | B | -1.3486 | |
| 2 | I | B | 0.2009 | |
| 3 | V | B | 1.0457 | |
| 4 | M | B | 0.0000 | |
| 5 | T | B | -0.2077 | |
| 6 | Q | B | 0.0000 | |
| 7 | S | B | -0.2130 | |
| 8 | P | B | 0.1731 | |
| 9 | L | B | 0.7852 | |
| 10 | S | B | -0.0123 | |
| 11 | L | B | -0.2544 | |
| 12 | P | B | -1.2498 | |
| 13 | V | B | 0.0000 | |
| 14 | T | B | -1.9216 | |
| 15 | P | B | -2.1519 | |
| 16 | G | B | -2.0465 | |
| 17 | E | B | -2.7460 | |
| 18 | P | B | -2.3856 | |
| 19 | A | B | 0.0000 | |
| 20 | S | B | -0.9027 | |
| 21 | I | B | 0.0000 | |
| 22 | S | B | -0.9338 | |
| 23 | S | B | 0.0000 | |
| 24 | K | B | -1.6153 | |
| 25 | T | B | 0.0000 | |
| 26 | S | B | -0.3680 | |
| 27 | T | B | -0.3893 | |
| 28 | S | B | -0.6256 | |
| 29 | T | B | 0.0000 | |
| 30 | T | B | -0.5335 | |
| 31 | D | B | -0.0740 | |
| 32 | S | B | 0.0956 | |
| 33 | Y | B | 0.8215 | |
| 34 | G | B | -0.2731 | |
| 35 | N | B | -0.5847 | |
| 36 | S | B | 0.0000 | |
| 37 | Y | B | -0.3551 | |
| 38 | V | B | 0.0000 | |
| 39 | G | B | 0.0000 | |
| 40 | W | B | 0.0000 | |
| 41 | Y | B | 0.0000 | |
| 42 | L | B | 0.0000 | |
| 43 | Q | B | 0.0000 | |
| 44 | K | B | -1.3987 | |
| 45 | S | B | -0.9065 | |
| 46 | G | B | -1.4634 | |
| 47 | Q | B | -2.1130 | |
| 48 | S | B | -1.4673 | |
| 49 | P | B | 0.0000 | |
| 50 | Q | B | -1.1182 | |
| 51 | L | B | 0.0000 | |
| 52 | L | B | 0.0000 | |
| 53 | I | B | 0.0000 | |
| 54 | Y | B | -0.2226 | |
| 55 | R | B | -1.1959 | |
| 56 | A | B | 0.0000 | |
| 57 | S | B | -0.5404 | |
| 58 | I | B | -0.0665 | |
| 59 | R | B | -1.3266 | |
| 60 | A | B | -0.7536 | |
| 61 | G | B | -0.8621 | |
| 62 | G | B | -1.1095 | |
| 63 | V | B | 0.0000 | |
| 64 | P | B | -1.4507 | |
| 65 | D | B | -2.4884 | |
| 66 | R | B | -2.2319 | |
| 67 | F | B | 0.0000 | |
| 68 | S | B | -1.4065 | |
| 69 | G | B | -0.9523 | |
| 70 | S | B | -1.0383 | |
| 71 | G | B | -1.2944 | |
| 72 | S | B | -1.1595 | |
| 73 | G | B | -0.9885 | |
| 74 | T | B | -1.3192 | |
| 75 | D | B | -2.1073 | |
| 76 | F | B | 0.0000 | |
| 77 | T | B | -1.2061 | |
| 78 | L | B | 0.0000 | |
| 79 | K | B | -2.1465 | |
| 80 | I | B | 0.0000 | |
| 81 | S | B | -2.4828 | |
| 82 | R | B | -3.4087 | |
| 83 | V | B | 0.0000 | |
| 84 | E | B | -2.2852 | |
| 85 | A | B | -1.2667 | |
| 86 | E | B | -1.9852 | |
| 87 | D | B | 0.0000 | |
| 88 | V | B | -0.4999 | |
| 89 | G | B | 0.0000 | |
| 90 | F | B | 0.2517 | |
| 91 | Y | B | 0.0000 | |
| 92 | Y | B | 0.0000 | |
| 93 | V | B | 0.0000 | |
| 94 | V | B | 0.0000 | |
| 95 | D | B | 0.0000 | |
| 96 | T | B | 0.0000 | |
| 97 | K | B | 0.1555 | |
| 98 | T | B | 0.6112 | |
| 99 | Y | B | 0.2914 | |
| 100 | P | B | -0.5620 | |
| 101 | I | B | 0.0000 | |
| 102 | G | B | 0.0000 | |
| 103 | F | B | 0.1408 | |
| 104 | G | B | 0.0000 | |
| 105 | Q | B | -0.7620 | |
| 106 | G | B | 0.0000 | |
| 107 | T | B | 0.0000 | |
| 108 | K | B | -0.5277 | |
| 109 | L | B | 0.0000 | |
| 110 | E | B | -1.4706 | |
| 111 | I | B | -1.7103 | |
| 112 | K | B | -2.3338 | |
| 113 | R | B | -2.1904 | |
| 114 | T | B | -0.4869 | |
| 115 | V | B | 0.9889 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| LD102A | -0.3744 | -0.0544 | View | CSV | PDB |
| LE102A | -0.3953 | -0.0487 | View | CSV | PDB |
| LR11A | -0.2831 | -0.0544 | View | CSV | PDB |
| VR3B | -0.4023 | -0.0403 | View | CSV | PDB |
| LK11A | -0.1008 | -0.0517 | View | CSV | PDB |
| VE3B | -0.2381 | -0.0397 | View | CSV | PDB |
| IK107A | -0.0374 | -0.0466 | View | CSV | PDB |
| YR33B | -0.0638 | -0.0343 | View | CSV | PDB |
| VE115B | -0.1807 | -0.0276 | View | CSV | PDB |
| VD115B | -0.1781 | -0.0273 | View | CSV | PDB |
| IR107A | 0.0648 | -0.0547 | View | CSV | PDB |
| YK33B | 0.2539 | -0.0329 | View | CSV | PDB |