Project name: query_structure

Status: done

Started: 2026-03-16 23:52:01
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGSKSDIRISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVYRTGGYRHRYLVLGEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)
Show buried residues

Minimal score value
-3.6543
Maximal score value
2.0266
Average score
-0.7184
Total score value
-73.9969

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.3684
2 Q A -1.1019
3 V A -1.3684
4 D A -1.4376
5 I A 0.0000
6 V A 1.2777
7 P A 0.3682
8 S A -0.4770
9 Q A -1.5599
10 G A 0.0000
11 E A -2.3131
12 I A 0.0000
13 S A -0.8428
14 V A -0.2004
15 G A -1.3389
16 E A -2.2776
17 S A -1.0533
18 K A -0.3734
19 F A 2.0266
20 F A 0.0000
21 L A 0.9475
22 C A 0.0000
23 Q A -1.5013
24 V A 0.0000
25 A A -0.7832
26 G A -0.9182
27 S A -1.5627
28 K A -2.6784
29 S A -2.4434
30 D A -2.9054
31 I A -1.6339
32 R A -1.2454
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.2169
37 S A -1.2627
38 P A -1.1836
39 N A -2.0098
40 G A -2.1168
41 E A -2.9617
42 K A -2.2347
43 L A 0.0000
44 T A -1.0051
45 P A -0.9590
46 N A -2.0306
47 Q A -2.1537
48 Q A -2.1225
49 R A -1.4614
50 I A 0.0000
51 S A -0.2386
52 V A 0.0000
53 V A 0.7404
54 W A -0.5596
55 N A -1.8914
56 D A -3.0396
57 D A -3.6543
58 S A -2.5453
59 S A 0.0000
60 S A 0.0000
61 T A 0.7379
62 L A 0.0000
63 T A 0.9045
64 I A 0.0000
65 Y A -0.6276
66 N A -2.0071
67 A A 0.0000
68 N A -1.0149
69 I A 0.3369
70 D A -1.4094
71 D A 0.0000
72 A A -0.3922
73 G A -0.1015
74 I A 0.5097
75 Y A 0.0000
76 K A -1.0931
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 Y A 0.3811
81 R A -0.5785
82 T A -0.9212
83 G A -1.1064
84 G A -1.0605
85 Y A -0.4033
86 R A -2.3567
87 H A -2.2128
88 R A -1.9155
89 Y A 0.4224
90 L A 2.0085
91 V A 1.9943
92 L A 1.2699
93 G A -0.1993
94 E A -1.8120
95 A A -1.4916
96 T A -0.6164
97 V A 0.0000
98 N A -0.8526
99 V A 0.0000
100 K A -1.2706
101 I A -0.4183
102 F A 0.4174
103 Q A -0.1833
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018