Project name: query_structure

Status: done

Started: 2026-03-17 00:28:24
Settings
Chain sequence(s) A: QVQLQESGGGLVQAGGSLRLSCAASGYIYRRYRMGWYRQAPGKEREFVAGINGGSSTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAYRIVWDLRVYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:46)
Show buried residues

Minimal score value
-3.4237
Maximal score value
3.1296
Average score
-0.8197
Total score value
-96.7301

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3969
2 V A -0.7677
3 Q A -1.7675
4 L A 0.0000
5 Q A -1.7201
6 E A 0.0000
7 S A -1.2000
8 G A -1.0198
9 G A -0.8217
10 G A -0.0298
11 L A 1.0398
12 V A 0.0135
13 Q A -1.2722
14 A A -1.4928
15 G A -1.3579
16 G A -0.8737
17 S A -1.1955
18 L A -0.8997
19 R A -2.1314
20 L A 0.0000
21 S A -0.8598
22 C A 0.0000
23 A A -1.1942
24 A A -0.8599
25 S A -0.8287
26 G A -0.0642
27 Y A 0.1778
28 I A 0.0000
29 Y A 0.0000
30 R A -3.0308
31 R A -2.6725
32 Y A -1.1670
33 R A -1.3407
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 Y A -0.2104
38 R A 0.0000
39 Q A -2.0103
40 A A -2.0097
41 P A -1.3985
42 G A -1.9376
43 K A -3.3212
44 E A -3.4237
45 R A -2.4714
46 E A -1.8056
47 F A -0.4798
48 V A 0.0000
49 A A 0.0000
50 G A 0.0000
51 I A 0.0000
52 N A -2.0889
53 G A -2.4190
54 G A -1.5692
55 S A -1.1284
56 S A -1.1097
57 T A -1.1196
58 N A -1.6643
59 Y A -1.3549
60 A A -1.5563
61 D A -2.5366
62 S A -1.7614
63 V A 0.0000
64 K A -2.7863
65 G A -1.7730
66 R A -1.4961
67 F A 0.0000
68 T A -1.0038
69 I A 0.0000
70 S A -0.6375
71 R A -1.3276
72 D A -2.0046
73 N A -2.6067
74 A A -1.8129
75 K A -2.4075
76 N A -2.0074
77 T A -1.5294
78 V A 0.0000
79 Y A -0.6574
80 L A 0.0000
81 Q A -1.2439
82 M A 0.0000
83 N A -1.3922
84 S A -1.2213
85 L A 0.0000
86 K A -2.4038
87 P A -1.9047
88 E A -2.3587
89 D A 0.0000
90 T A -0.9342
91 A A 0.0000
92 V A -0.5970
93 Y A 0.0000
94 Y A -0.4724
95 C A 0.0000
96 A A 0.0000
97 A A 0.0000
98 Y A 0.3208
99 R A 0.1485
100 I A 2.3965
101 V A 3.1296
102 W A 2.4944
103 D A 1.3689
104 L A 1.3121
105 R A -0.5133
106 V A 0.2392
107 Y A -0.1467
108 W A -0.0552
109 G A -0.8264
110 Q A -1.5825
111 G A -1.0061
112 T A 0.0000
113 Q A -1.1860
114 V A 0.0000
115 T A -0.3063
116 V A 0.0000
117 S A -0.7822
118 S A -1.0471
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018