Project name: query_structure

Status: done

Started: 2026-03-16 21:25:04
Settings
Chain sequence(s) A: MIPRGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVLASTNYYIKVRAGDNKYMHLKVFNGPPGQNADRVLTGYQVDKNKDDELTGF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-4.2182
Maximal score value
1.8262
Average score
-1.1975
Total score value
-117.3569

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.6982
2 I A 1.8262
3 P A 0.3137
4 R A -0.9495
5 G A -0.9833
6 L A -0.6646
7 S A -1.0437
8 E A -2.1288
9 A A -1.7028
10 K A -1.5477
11 P A -0.9281
12 A A -0.9208
13 T A -1.2832
14 P A -1.7916
15 E A -2.8985
16 I A 0.0000
17 Q A -2.8413
18 E A -3.9038
19 I A 0.0000
20 V A 0.0000
21 D A -4.0288
22 K A -3.3222
23 V A 0.0000
24 K A -2.5375
25 P A -2.1315
26 Q A -2.0322
27 L A 0.0000
28 E A -3.0369
29 E A -3.7059
30 K A -3.2039
31 T A -2.5232
32 N A -3.3783
33 E A -3.2823
34 T A -1.9764
35 Y A 0.0000
36 G A -1.6989
37 K A -2.6992
38 L A 0.0000
39 E A -2.3313
40 A A -1.6307
41 V A -0.6195
42 Q A -1.3664
43 Y A 0.0000
44 K A 0.0000
45 T A -0.1182
46 Q A 0.2661
47 V A 1.6733
48 L A 1.3049
49 A A 0.7851
50 S A 0.7562
51 T A 0.8056
52 N A 0.5526
53 Y A 0.2261
54 Y A 0.0000
55 I A 0.0000
56 K A 0.0000
57 V A 0.0000
58 R A -2.8025
59 A A -2.2194
60 G A -2.4962
61 D A -2.9095
62 N A -3.7105
63 K A -3.4126
64 Y A 0.0000
65 M A 0.0000
66 H A 0.0000
67 L A 0.0000
68 K A 0.0380
69 V A 0.0000
70 F A 0.1862
71 N A -0.5160
72 G A -0.9986
73 P A -0.8540
74 P A -1.0600
75 G A -1.4767
76 Q A -2.4226
77 N A -2.6746
78 A A -2.1363
79 D A -2.6280
80 R A -1.5834
81 V A -0.2385
82 L A 0.0000
83 T A 0.1602
84 G A 0.1222
85 Y A 0.2295
86 Q A -0.3032
87 V A -0.5126
88 D A -2.3710
89 K A -3.2410
90 N A -4.2122
91 K A -4.2182
92 D A -3.7650
93 D A -3.4291
94 E A -3.0898
95 L A 0.0000
96 T A -0.5369
97 G A -0.1415
98 F A 0.8699
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018