Project name: obj1 [mutate: GA111C, QG112C, TF114C, VW116C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	VW116C,TF114C,QG112C,GA111C
Energy difference between WT (input) and mutated protein (by FoldX)	25.771 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:44)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:10)

• Minimal score value: -3.3326
• Maximal score value: 2.1072
• Average score: -0.5909
• Total score value: -70.9081

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0224
2	V	C	-0.9455
3	Q	C	-1.0256
4	L	C	0.0000
5	V	C	1.5117
6	E	C	0.0000
7	S	C	0.1802
8	G	C	-0.4383
9	G	C	0.4208
10	G	C	1.1271
11	L	C	1.4733
12	V	C	-0.0183
13	Q	C	-1.3417
14	P	C	-1.4853
15	G	C	-1.4025
16	G	C	-0.9341
17	S	C	-1.1621
18	L	C	-0.8076
19	R	C	-2.0337
20	L	C	0.0000
21	S	C	-0.2581
22	C	C	0.0000
23	A	C	0.0627
24	A	C	0.0000
25	S	C	-0.1198
26	D	C	0.0000
27	F	C	1.5446
28	T	C	0.2507
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1448
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3323
40	A	C	-1.0044
41	P	C	-1.3040
42	G	C	-1.4369
43	K	C	-2.1399
44	G	C	-1.0697
45	L	C	0.3648
46	E	C	-0.4014
47	W	C	0.3354
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6456
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6309
81	L	C	0.0000
82	Q	C	-1.2044
83	M	C	0.0000
84	N	C	-1.2976
85	S	C	-1.2095
86	L	C	0.0000
87	R	C	-2.4704
88	A	C	-1.8930
89	E	C	-2.3446
90	D	C	0.0000
91	T	C	-0.4384
92	A	C	0.0000
93	I	C	1.3012
94	Y	C	0.0000
95	Y	C	1.0497
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1893
101	D	C	-3.3326
102	G	C	-2.0859
103	F	C	-1.2303
104	N	C	-2.4278
105	K	C	-3.1838
106	G	C	-1.9052
107	F	C	-0.9824
108	D	C	-1.1050
109	Y	C	-0.2117
110	W	C	0.8266
111	A	C	0.0000	mutated: GA111C
112	G	C	0.1722	mutated: QG112C
113	G	C	0.8977
114	F	C	1.5162	mutated: TF114C
115	L	C	2.1072
116	W	C	0.0000	mutated: VW116C
117	T	C	0.3444
118	V	C	0.0000
119	S	C	-0.7809
120	S	C	-1.0630