Project name: 565db52a34deeb3

Chain sequence(s)	A: METVITADVLRRGGVDVTRAGLAGNGPVTCSRNVVIKPDAAFTDAIKKDYDVIIRPGGMKGAESLAASSAVGDLLKKQEEKNAFIACICAAPIALKSHGIAKGKKITSHPSVDKQLKEAGYNYSEDRVVVDGKLMTSRGPGTTFEFALAIVEILVGKE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:20)

• Minimal score value: -4.1995
• Maximal score value: 1.744
• Average score: -0.9524
• Total score value: -150.4745

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.2820
2	E	A	0.7130
3	T	A	0.4037
4	V	A	0.6079
5	I	A	0.7340
6	T	A	0.0000
7	A	A	-1.1880
8	D	A	-2.2077
9	V	A	0.0000
10	L	A	0.0000
11	R	A	-3.3277
12	R	A	-3.3391
13	G	A	-1.8362
14	G	A	-1.6657
15	V	A	-1.7186
16	D	A	-2.4084
17	V	A	-1.4315
18	T	A	-1.1079
19	R	A	-1.3866
20	A	A	-1.1728
21	G	A	0.0000
22	L	A	0.2525
23	A	A	-0.0334
24	G	A	-0.8769
25	N	A	-2.3426
26	G	A	-1.5507
27	P	A	-0.6361
28	V	A	0.6677
29	T	A	0.4432
30	C	A	0.0608
31	S	A	-1.0315
32	R	A	-1.7680
33	N	A	-0.9173
34	V	A	1.3422
35	V	A	1.7440
36	I	A	0.4275
37	K	A	-1.8709
38	P	A	0.0000
39	D	A	-2.5979
40	A	A	-2.0147
41	A	A	0.0000
42	F	A	0.0000
43	T	A	-1.0275
44	D	A	-2.1978
45	A	A	0.0000
46	I	A	-1.3252
47	K	A	-2.4408
48	K	A	-2.5769
49	D	A	-3.0034
50	Y	A	-1.8357
51	D	A	-2.0973
52	V	A	-0.5189
53	I	A	0.0000
54	I	A	0.2555
55	R	A	0.0000
56	P	A	0.1727
57	G	A	-0.4546
58	G	A	-0.9080
59	M	A	-0.9849
60	K	A	-2.3009
61	G	A	-1.5006
62	A	A	0.0000
63	E	A	-2.4377
64	S	A	-1.3940
65	L	A	0.0000
66	A	A	-1.0319
67	A	A	-0.5718
68	S	A	-0.5646
69	S	A	-0.6744
70	A	A	-0.6590
71	V	A	0.0000
72	G	A	0.0000
73	D	A	-2.6137
74	L	A	0.0000
75	L	A	0.0000
76	K	A	-3.6247
77	K	A	-3.9615
78	Q	A	0.0000
79	E	A	-3.8140
80	E	A	-4.1995
81	K	A	-4.1101
82	N	A	-3.6427
83	A	A	-2.6444
84	F	A	-0.9396
85	I	A	0.0000
86	A	A	0.0000
87	C	A	0.0000
88	I	A	0.0000
89	C	A	-0.3090
90	A	A	0.0000
91	A	A	0.0000
92	P	A	0.0000
93	I	A	-0.8925
94	A	A	0.0000
95	L	A	0.0000
96	K	A	-1.1494
97	S	A	-0.6908
98	H	A	-0.8440
99	G	A	-0.9400
100	I	A	0.0000
101	A	A	-1.8664
102	K	A	-2.4534
103	G	A	-2.0841
104	K	A	-2.2026
105	K	A	-1.9328
106	I	A	0.0000
107	T	A	0.0000
108	S	A	0.0000
109	H	A	-1.2573
110	P	A	-1.1760
111	S	A	-0.9430
112	V	A	0.0000
113	D	A	-2.1557
114	K	A	-3.0604
115	Q	A	-2.4636
116	L	A	0.0000
117	K	A	-2.7994
118	E	A	-3.0086
119	A	A	-1.5008
120	G	A	-1.8261
121	Y	A	-1.8813
122	N	A	-2.0464
123	Y	A	-1.5163
124	S	A	-2.0540
125	E	A	-3.1286
126	D	A	-3.2284
127	R	A	-3.0162
128	V	A	-1.0442
129	V	A	0.0000
130	V	A	-0.0386
131	D	A	-1.1675
132	G	A	-1.2875
133	K	A	-1.4128
134	L	A	0.0000
135	M	A	0.0000
136	T	A	0.0000
137	S	A	0.0000
138	R	A	-1.5839
139	G	A	0.0000
140	P	A	0.1030
141	G	A	-0.3617
142	T	A	0.0000
143	T	A	0.0000
144	F	A	1.6707
145	E	A	0.1558
146	F	A	0.0000
147	A	A	0.0000
148	L	A	0.7964
149	A	A	0.4879
150	I	A	0.0000
151	V	A	-0.2132
152	E	A	-0.8018
153	I	A	0.4173
154	L	A	0.6916
155	V	A	0.7995
156	G	A	-0.8614
157	K	A	-2.4260
158	E	A	-2.5914